|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (0, 0) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1J1Y) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1J1Y) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1J1Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1J1Y) |
Exons (0, 0)| (no "Exon" information available for 1J1Y) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:116 aligned with Q5SJP3_THET8 | Q5SJP3 from UniProtKB/TrEMBL Length:136 Alignment length:116 11 21 31 41 51 61 71 81 91 101 111 Q5SJP3_THET8 2 RDPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAVALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRL 117 SCOP domains d1j1ya_ A: Phenylacetic acid degradation protein PaaI SCOP domains CATH domains 1j1yA00 A:2-117 [code=3.10.129.10, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------- Transcript 1j1y A 2 RDPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAVALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRL 117 11 21 31 41 51 61 71 81 91 101 111 Chain B from PDB Type:PROTEIN Length:115 aligned with Q5SJP3_THET8 | Q5SJP3 from UniProtKB/TrEMBL Length:136 Alignment length:115 12 22 32 42 52 62 72 82 92 102 112 Q5SJP3_THET8 3 DPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAVALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRL 117 SCOP domains d1j1yb_ B: Phenylacetic acid degradation protein PaaI SCOP domains CATH domains 1j1yB00 B:3-117 [code=3.10.129.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------- Transcript 1j1y B 3 DPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAVALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRL 117 12 22 32 42 52 62 72 82 92 102 112
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1J1Y) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q5SJP3_THET8 | Q5SJP3)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|