Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A HIS-TAGGED SERINE HYDROLASE INVOLVED IN THE CARBAZOLE DEGRADATION (CARC ENZYME)
 
Authors :  H. Habe, K. Morii, S. Fushinobu, J. W. Nam, Y. Ayabe, T. Yoshida, T. Wakagi, H. Yamane, H. Nojiri, T. Omori
Date :  05 Dec 02  (Deposition) - 17 Jun 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.86
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Carbazole Degradation, Meta Cleavage Product Hydrolase, Histidine Tagged Protein, Alpha/Beta-Hydrolase, Beta- Ketolase, Dioxin, Aromatic Compounds, Dibenzofuran (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Habe, K. Morii, S. Fushinobu, J. W. Nam, Y. Ayabe, T. Yoshida, T. Wakagi, H. Yamane, H. Nojiri, T. Omori
Crystal Structure Of A Histidine-Tagged Serine Hydrolase Involved In The Carbazole Degradation (Carc Enzyme).
Biochem. Biophys. Res. Commun. V. 303 631 2003
PubMed-ID: 12659866  |  Reference-DOI: 10.1016/S0006-291X(03)00375-9
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - META CLEAVAGE COMPOUND HYDROLASE
    Chains: A
    EC Number: 3.7.1.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PECJ3
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PET26B(+)
    Expression System Vector Type: PLASMID
    Gene: CARC
    Organism Scientific: JANTHINOBACTERIUM
    Organism Taxid: 29580
    Strain: J3
    Synonym: SERINE HYDROLASE INVOLVED IN THE CARBAZOLE DEGRADATION, CARC

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1J1I)

(-) Sites  (0, 0)

(no "Site" information available for 1J1I)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1J1I)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1J1I)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1J1I)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1J1I)

(-) Exons   (0, 0)

(no "Exon" information available for 1J1I)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:258
 aligned with Q84II3_JANS3 | Q84II3 from UniProtKB/TrEMBL  Length:290

    Alignment length:268
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274        
         Q84II3_JANS3    15 AFVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDLRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSLR 282
               SCOP domains d1j1ia_ A: Meta cleavage compound hydrolase CarC                                                                                                                                                                                                                             SCOP domains
               CATH domains 1j1iA00 A:15-282  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..eeeeeeee....eeeee.......hhhhhhh.hhhhhh...eeeee...............hhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhhhhhh...eeeeeee........----------...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.....eeeeee......hhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1j1i A  15 AYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVE----------YDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSLR 282
                                    24        34        44        54        64        74        84        94       104       114       124       134       144|        - |     164       174       184       194       204       214       224       234       244       254       264       274        
                                                                                                                                                            145        156
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1J1I)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q84II3_JANS3 | Q84II3)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1j1i)
 
  Sites
(no "Sites" information available for 1j1i)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1j1i)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1j1i
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q84II3_JANS3 | Q84II3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.7.1.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q84II3_JANS3 | Q84II3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1J1I)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1J1I)