|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (0, 0)| (no "Site" information available for 1IZM) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1IZM) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1IZM) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1IZM) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1IZM) |
Exons (0, 0)| (no "Exon" information available for 1IZM) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:170 aligned with Y817_HAEIN | P44882 from UniProtKB/Swiss-Prot Length:182 Alignment length:170 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 Y817_HAEIN 2 LISHSDLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFELGLTEDENVFTQADSLSDWANQFLLGIGLAQPELAKEKGEIGEAVDDLQDICQLGYDEDDNEEELAEALEEIIEYVRTIAMLFYSHFN 171 SCOP domains d1izma_ A: Hypothetical protein HI0817 SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1izm A 2 LISHSDmNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFELGLTEDENVFTQADSLSDWANQFLLGIGLAQPELAKEKGEIGEAVDDLQDICQLGYDEDDNEEELAEALEEIIEYVRTIAmLFYSHFN 171 | 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 | 171 8-MSE 164-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1IZM) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IZM) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1IZM)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|