|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1IW4) |
Sites (0, 0)| (no "Site" information available for 1IW4) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1IW4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1IW4) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1IW4) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:55 aligned with ITRP_HALRO | P16589 from UniProtKB/Swiss-Prot Length:55 Alignment length:55 10 20 30 40 50 ITRP_HALRO 1 AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE 55 SCOP domains d1iw4a_ A: Ascidian trypsin inhibitor SCOP domains CATH domains 1iw4A00 A:1-55 [code=3.30.60.30, no name defined] CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE KAZAL_2 PDB: A:1-55 UniProt: 1-55 PROSITE Transcript ------------------------------------------------------- Transcript 1iw4 A 1 AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE 55 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IW4) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (ITRP_HALRO | P16589)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|