Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE SEA DOMAIN FROM MURINE HYPOTHETICAL PROTEIN HOMOLOGOUS TO HUMAN MUCIN 16
 
Authors :  T. Maeda, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  02 Apr 02  (Deposition) - 02 Oct 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Sea Domain, Mucin 16, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Maeda, M. Inoue, S. Koshiba, T. Yabuki, M. Aoki, E. Nunokawa, E. Seki, T. Matsuda, Y. Motoda, A. Kobayashi, F. Hiroyasu, M. Shirouzu, T. Terada, N. Hayami, Y. Ishizuka, N. Shinya, A. Tatsuguchi, M. Yoshida, H. Hirota, Y. Matsuo, K. Tani, T. Arakawa, P. Carninci, J. Kawai, Y. Hayashizaki, T. Kigawa, S. Yokoyama
Solution Structure Of The Sea Domain From The Murine Homologue Of Ovarian Cancer Antigen Ca125 (Muc16)
J. Biol. Chem. V. 279 13174 2004
PubMed-ID: 14764598  |  Reference-DOI: 10.1074/JBC.M309417200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN 1110008I14RIK
    Chains: A
    Engineered: YES
    Expression System Plasmid: P011109-16
    Expression System Vector Type: PLASMID
    Fragment: SEA DOMAIN(RESIDUES 67-185)
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Other Details: CELL-FREE PROTEIN SYNTHESIS

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1IVZ)

(-) Sites  (0, 0)

(no "Site" information available for 1IVZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1IVZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1IVZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1IVZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1IVZ)

(-) Exons   (0, 0)

(no "Exon" information available for 1IVZ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:132
 aligned with Q9D1H1_MOUSE | Q9D1H1 from UniProtKB/TrEMBL  Length:258

    Alignment length:200
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200
         Q9D1H1_MOUSE     1 MTSGSTVVTLEALFSSHLDPNLVKQVFLNKTLNASSHWLGATYQLKDLHVIDMKTSILLPAEIPTTSSSSQHFNLNFTITNLPYSQDIAQPSTTKYQQTKRSIENALNQLFRNSSIKSYFSDCQVLAFRSVSNNNNHTGVDSLCNFSPLARRVDRVAIYEEFLRMTHNGTQLLNFTLDRKSVFVDGYSQNRDDDVMKNSG 200
               SCOP domains d1ivz                                                           a_ A: SEA domain from the hypothetical protein homologous to mucin 16                                                                    SCOP domains
               CATH domains 1ivzA                                                           00 A:1-132  [code=3.30.70.960, no name defined]                                                                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....-----------------------------------------------------------.......eeeeeee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhh.....eeee...eee.........eeeeeeee.......hhhhhhhhhhhhh....ee..ee......eee--e.-------.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ivz A   1 GSSGS-----------------------------------------------------------SGSSSSQHFNLNFTITNLPYSQDIAQPSTTKYQQTKRSIENALNQLFRNSSIKSYFSDCQVLAFRSVSNNNNHTGVDSLCNFSPLARRVDRVAIYEEFLRMTHNGTQLLNFTLDRKSVFVD--SG-------PSSG 132
                                |    -         -         -         -         -         -    |   11        21        31        41        51        61        71        81        91       101       111       121    |  ||-      |132
                                5                                                           6                                                                                                                     126  ||     129   
                                                                                                                                                                                                                     127|           
                                                                                                                                                                                                                      128
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IVZ)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (Q9D1H1_MOUSE | Q9D1H1)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ivz)
 
  Sites
(no "Sites" information available for 1ivz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ivz)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ivz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9D1H1_MOUSE | Q9D1H1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9D1H1_MOUSE | Q9D1H1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1IVZ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1IVZ)