|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1IUK) |
Sites (0, 0)| (no "Site" information available for 1IUK) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1IUK) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1IUK) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1IUK) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1IUK) |
Exons (0, 0)| (no "Exon" information available for 1IUK) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:136 aligned with Q8GHJ5_THETH | Q8GHJ5 from UniProtKB/TrEMBL Length:140 Alignment length:136 10 20 30 40 50 60 70 80 90 100 110 120 130 Q8GHJ5_THETH 1 MNDQELRAYLSQAKTIAVLGAHKDPSRPAHYVPRYLREQGYRVLPVNPRFQGEELFGEEAVASLLDLKEPVDILDVFRPPSALMDHLPEVLALRPGLVWLQSGIRHPEFEKALKEAGIPVVADRCLMVEHKRLFRG 136 SCOP domains d1iuka_ A: Hypothetical protein TT1466 SCOP domains CATH domains 1iukA00 A:1-136 NAD(P)-binding Rossmann-like Domain CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript 1iuk A 1 MNDQELRAYLSQAKTIAVLGAHKDPSRPAHYVPRYLREQGYRVLPVNPRFQGEELFGEEAVASLLDLKEPVDILDVFRPPSALMDHLPEVLALRPGLVWLQSGIRHPEFEKALKEAGIPVVADRCLMVEHKRLFRG 136 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IUK) |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q8GHJ5_THETH | Q8GHJ5)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|