Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN GAMMA1-ADAPTIN EAR DOMAIN
 
Authors :  T. Nogi, Y. Shiba, M. Kawasaki, T. Shiba, N. Matsugaki, N. Igarashi, M. Suzuki, R. Kato, H. Takatsu, K. Nakayama, S. Wakatsuki
Date :  19 Feb 02  (Deposition) - 10 Jul 02  (Release) - 13 May 08  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Coated Pits, Endocytosis (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Nogi, Y. Shiba, M. Kawasaki, T. Shiba, N. Matsugaki, N. Igarashi, M. Suzuki, R. Kato, H. Takatsu, K. Nakayama, S. Wakatsuki
Structural Basis For The Accessory Protein Recruitment By The Gamma-Adaptin Ear Domain.
Nat. Struct. Biol. V. 9 527 2002
PubMed-ID: 12042876
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GAMMA1-ADAPTIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX4T-2
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentEAR DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1IU1)

(-) Sites  (0, 0)

(no "Site" information available for 1IU1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1IU1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1IU1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1IU1)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GAEPS50180 Gamma-adaptin ear (GAE) domain profile.AP1G1_HUMAN702-817  1B:702-817
Biological Unit 1 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GAEPS50180 Gamma-adaptin ear (GAE) domain profile.AP1G1_HUMAN702-817  0-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GAEPS50180 Gamma-adaptin ear (GAE) domain profile.AP1G1_HUMAN702-817  1B:702-817

(-) Exons   (4, 8)

Asymmetric Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000002999801bENSE00001289832chr16:71842976-71842666311AP1G1_HUMAN-00--
1.5ENST000002999805ENSE00002190448chr16:71823385-71823182204AP1G1_HUMAN1-67670--
1.6ENST000002999806ENSE00001629999chr16:71808495-71808371125AP1G1_HUMAN68-109420--
1.7ENST000002999807ENSE00001770736chr16:71807265-71807124142AP1G1_HUMAN109-156480--
1.9ENST000002999809ENSE00001106266chr16:71805155-7180505997AP1G1_HUMAN157-189330--
1.10ENST0000029998010ENSE00001106233chr16:71803602-7180352677AP1G1_HUMAN189-214260--
1.12ENST0000029998012ENSE00001106277chr16:71799487-7179939296AP1G1_HUMAN215-246320--
1.13ENST0000029998013ENSE00001106226chr16:71798629-7179854981AP1G1_HUMAN247-273270--
1.14ENST0000029998014ENSE00001106218chr16:71798351-7179825399AP1G1_HUMAN274-306330--
1.15ENST0000029998015ENSE00001106283chr16:71795470-7179541556AP1G1_HUMAN307-325190--
1.16ENST0000029998016ENSE00001106247chr16:71792824-71792711114AP1G1_HUMAN325-363390--
1.17ENST0000029998017ENSE00001106285chr16:71790062-71789922141AP1G1_HUMAN363-410480--
1.18ENST0000029998018ENSE00001106244chr16:71787790-7178773655AP1G1_HUMAN410-428190--
1.19bENST0000029998019bENSE00001106254chr16:71784235-71784113123AP1G1_HUMAN429-469410--
1.20ENST0000029998020ENSE00001611084chr16:71783886-7178379790AP1G1_HUMAN470-499300--
1.21ENST0000029998021ENSE00001629994chr16:71782281-71782154128AP1G1_HUMAN500-542430--
1.22ENST0000029998022ENSE00001754229chr16:71780595-71780491105AP1G1_HUMAN542-577360--
1.23ENST0000029998023ENSE00001788772chr16:71779517-71779376142AP1G1_HUMAN577-624480--
1.24ENST0000029998024ENSE00001642630chr16:71779173-71779047127AP1G1_HUMAN625-667430--
1.25ENST0000029998025ENSE00001734186chr16:71773244-71773137108AP1G1_HUMAN667-703372A:703-703
B:700-703
1
4
1.26ENST0000029998026ENSE00001647477chr16:71773005-71772845161AP1G1_HUMAN703-756542A:703-756
B:703-756
54
54
1.28ENST0000029998028ENSE00001751766chr16:71768610-7176851299AP1G1_HUMAN757-789332A:757-789
B:757-789
33
33
1.29cENST0000029998029cENSE00001324792chr16:71767062-717629034160AP1G1_HUMAN790-822332A:790-822
B:790-822
33
33

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:120
 aligned with AP1G1_HUMAN | O43747 from UniProtKB/Swiss-Prot  Length:822

    Alignment length:120
                                   712       722       732       742       752       762       772       782       792       802       812       822
          AP1G1_HUMAN   703 GIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ 822
               SCOP domains d1iu1a_ A: Gamma1-adaptin domain                                                                                         SCOP domains
               CATH domains 1iu1A00 A:703-822  [code=2.60.40.1230, no name defined]                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeee..eeeeeeeee......eeeeeeeeee......eeeeeeee.....eeee........hhhhh..eeeeeeee.........eeeeeeee..eeeeeeee....hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GAE  PDB: - UniProt: 702-817                                                                                       ----- PROSITE
           Transcript 1 (1) 1-----------------------------------------------------Exon 1.28  PDB: A:757-789        Exon 1.29c  PDB: A:790-822        Transcript 1 (1)
           Transcript 1 (2) Exon 1.26  PDB: A:703-756 UniProt: 703-756            ------------------------------------------------------------------ Transcript 1 (2)
                 1iu1 A 703 GIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ 822
                                   712       722       732       742       752       762       772       782       792       802       812       822

Chain B from PDB  Type:PROTEIN  Length:123
 aligned with AP1G1_HUMAN | O43747 from UniProtKB/Swiss-Prot  Length:822

    Alignment length:123
                                   709       719       729       739       749       759       769       779       789       799       809       819   
          AP1G1_HUMAN   700 IAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ 822
               SCOP domains d1iu1b_ B: Gamma1-adaptin domain                                                                                            SCOP domains
               CATH domains 1iu1B00 B:700-822  [code=2.60.40.1230, no name defined]                                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee..eeeeeeeee......eeeeeeeeee......eeeeeeee.....eeee........hhhhh..eeeeeeee.........eeeeeeee..eeeeeeee....hhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --GAE  PDB: B:702-817 UniProt: 702-817                                                                                ----- PROSITE
           Transcript 1 (1) 1.25-----------------------------------------------------Exon 1.28  PDB: B:757-789        Exon 1.29c  PDB: B:790-822        Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.26  PDB: B:703-756 UniProt: 703-756            ------------------------------------------------------------------ Transcript 1 (2)
                 1iu1 B 700 IAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ 822
                                   709       719       729       739       749       759       769       779       789       799       809       819   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IU1)

(-) Gene Ontology  (34, 34)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (AP1G1_HUMAN | O43747)
molecular function
    GO:0030742    GTP-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules) using energy from the hydrolysis of GTP.
    GO:0017137    Rab GTPase binding    Interacting selectively and non-covalently with Rab protein, any member of the Rab subfamily of the Ras superfamily of monomeric GTPases.
    GO:0019894    kinesin binding    Interacting selectively and non-covalently and stoichiometrically with kinesin, a member of a superfamily of microtubule-based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0008565    protein transporter activity    Enables the directed movement of proteins into, out of or within a cell, or between cells.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0090160    Golgi to lysosome transport    The directed movement of substances from the Golgi to lysosomes.
    GO:0019886    antigen processing and presentation of exogenous peptide antigen via MHC class II    The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
    GO:0035646    endosome to melanosome transport    The directed movement of substances from endosomes to the melanosome, a specialised lysosome-related organelle.
    GO:0006886    intracellular protein transport    The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
    GO:0032438    melanosome organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a melanosome. A melanosome is a tissue-specific, membrane-bounded cytoplasmic organelle within which melanin pigments are synthesized and stored.
    GO:0043323    positive regulation of natural killer cell degranulation    Any process that activates or increases the frequency, rate or extent of natural killer cell degranulation.
    GO:0045954    positive regulation of natural killer cell mediated cytotoxicity    Any process that activates or increases the frequency, rate or extent of natural killer cell mediated cytotoxicity.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0050690    regulation of defense response to virus by virus    Any viral process that modulates the frequency, rate, or extent of the antiviral response of the host cell or organism.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
    GO:0030119    AP-type membrane coat adaptor complex    Any of several heterotetrameric complexes that link clathrin (or another coat-forming molecule, as hypothesized for AP-3 and AP-4) to a membrane surface; they are found on coated pits and coated vesicles, and mediate sorting of cargo proteins into vesicles. Each AP complex contains two large (a beta and one of either an alpha, gamma, delta, or epsilon) subunits (110-130 kDa), a medium (mu) subunit (approximately 50 kDa), and a small (sigma) subunit (15-20 kDa).
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0000139    Golgi membrane    The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
    GO:0030131    clathrin adaptor complex    A membrane coat adaptor complex that links clathrin to a membrane.
    GO:0030669    clathrin-coated endocytic vesicle membrane    The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
    GO:0030136    clathrin-coated vesicle    A vesicle with a coat formed of clathrin connected to the membrane via one of the clathrin adaptor complexes.
    GO:0030665    clathrin-coated vesicle membrane    The lipid bilayer surrounding a clathrin-coated vesicle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0030659    cytoplasmic vesicle membrane    The lipid bilayer surrounding a cytoplasmic vesicle.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005765    lysosomal membrane    The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030117    membrane coat    Any of several different proteinaceous coats that can associate with membranes. Membrane coats include those formed by clathrin plus an adaptor complex, the COPI and COPII complexes, and possibly others. They are found associated with membranes on many vesicles as well as other membrane features such as pits and perhaps tubules.
    GO:0055037    recycling endosome    An organelle consisting of a network of tubules that functions in targeting molecules, such as receptors transporters and lipids, to the plasma membrane.
    GO:0032588    trans-Golgi network membrane    The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1iu1)
 
  Sites
(no "Sites" information available for 1iu1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1iu1)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1iu1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AP1G1_HUMAN | O43747
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AP1G1_HUMAN | O43747
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1IU1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1IU1)