|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1IS4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1IS4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1IS4) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1IS4) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:134 aligned with LEG2_CONMY | Q9YIC2 from UniProtKB/Swiss-Prot Length:136 Alignment length:134 12 22 32 42 52 62 72 82 92 102 112 122 132 LEG2_CONMY 3 DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE 136 SCOP domains d1is4a_ A: Congerin II SCOP domains CATH domains 1is4A00 A:2-135 [code=2.60.120.200, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -GALECTIN PDB: A:3-135 UniProt: 4-136 PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 1is4 A 2 DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE 135 11 21 31 41 51 61 71 81 91 101 111 121 131
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IS4) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (LEG2_CONMY | Q9YIC2)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|