|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1IS1) |
Sites (0, 0)| (no "Site" information available for 1IS1) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1IS1) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1IS1) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1IS1) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1IS1) |
Exons (0, 0)| (no "Exon" information available for 1IS1) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:185 aligned with RRF_VIBPA | Q8GRF5 from UniProtKB/Swiss-Prot Length:185 Alignment length:185 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 RRF_VIBPA 1 MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV 185 SCOP domains d1is1a_ A: Ribosome recycling factor, RRF SCOP domains CATH domains -1is1A01 A:2-30,A:106-185 1is1A02 A:31-105 [code=3.30.1360.40, no name defined] 1is1A01 A:2-30,A:106-185 [code=1.10.132.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1is1 A 1 MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVFDKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLKALLKDKEISEDEDRKAQEEIQKLTDVAVKKIDEVLAAKEKELMEV 185 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (2, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IS1) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RRF_VIBPA | Q8GRF5)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|