|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1IGU) |
(no "Site" information available for 1IGU) |
(no "SS Bond" information available for 1IGU) |
(no "Cis Peptide Bond" information available for 1IGU) |
(no "SAP(SNP)/Variant" information available for 1IGU) |
(no "PROSITE Motif" information available for 1IGU) |
(no "Exon" information available for 1IGU) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:59 aligned with KORB2_ECOLX | P07674 from UniProtKB/Swiss-Prot Length:358 Alignment length:59 309 319 329 339 349 KORB2_ECOLX 300 DPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG 358 SCOP domains d1igua_ A: Transcriptional repressor protein KorB SCOP domains CATH domains 1iguA00 A:300-358 [code=2.30.30.150, no name defined] CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 1igu A 300 DPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG 358 309 319 329 339 349 Chain B from PDB Type:PROTEIN Length:60 aligned with KORB2_ECOLX | P07674 from UniProtKB/Swiss-Prot Length:358 Alignment length:60 308 318 328 338 348 358 KORB2_ECOLX 299 PDPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG 358 SCOP domains d1igub_ B: Transcriptional repressor protein KorB SCOP domains CATH domains 1iguB00 B:299-358 [code=2.30.30.150, no name defined] CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------ Transcript 1igu B 299 PDPDKLKKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG 358 308 318 328 338 348 358
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1IGU) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (KORB2_ECOLX | P07674)
|
|
|
|
|
|
|