|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (0, 0) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1IBH) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1IBH) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:151 aligned with SODC_PHOLE | P00446 from UniProtKB/Swiss-Prot Length:173 Alignment length:151 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 SODC_PHOLE 23 QDLTVKMTDLQTGKPVGTIELSQNKYGVVFTPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ 173 SCOP domains d1ibha_ A: Cu,Zn superoxide dismutase, SOD SCOP domains CATH domains 1ibhA00 A:1-151 [code=2.60.40.200, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------SOD_CU_ZN_1-------------------------------------------------------------------------------------SOD_CU_ZN_2 - PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ibh A 1 QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPGIHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ 151 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1IBH) |
Gene Ontology (9, 9)|
Asymmetric Unit(hide GO term definitions) Chain A (SODC_PHOLE | P00446)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|