|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 9)| Asymmetric/Biological Unit (2, 9) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1I3C) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1I3C) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1I3C) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1I3C) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:144 aligned with RCP1_SYNY3 | Q55169 from UniProtKB/Swiss-Prot Length:147 Alignment length:144 147 15 25 35 45 55 65 75 85 95 105 115 125 135 145 | RCP1_SYNY3 6 NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPAA-- - SCOP domains d1i3ca_ A: Response regulator for cyanobacterial phytochrome SCOP domains CATH domains 1i3cA00 A:6-149 [code=3.40.50.2300, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ----RESPONSE_REGULATORY PDB: A:10-135 UniProt: 10-135 -------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1i3c A 6 NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAmAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKmVQGIESFWLETVTLPAAPG 149 15 25 35 45 | 55 65 75 85 95 105 115 125 | 135 145 47-MSE 130-MSE Chain B from PDB Type:PROTEIN Length:140 aligned with RCP1_SYNY3 | Q55169 from UniProtKB/Swiss-Prot Length:147 Alignment length:140 16 26 36 46 56 66 76 86 96 106 116 126 136 146 RCP1_SYNY3 7 PPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPA 146 SCOP domains d1i3cb_ B: Response regulator for cyanobacterial phytochrome SCOP domains CATH domains 1i3cB00 B:7-146 [code=3.40.50.2300, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---RESPONSE_REGULATORY PDB: B:10-135 UniProt: 10-135 ----------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1i3c B 7 PPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAmAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKmVQGIESFWLETVTLPA 146 16 26 36 46| 56 66 76 86 96 106 116 126 | 136 146 47-MSE 130-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1I3C) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (RCP1_SYNY3 | Q55169)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|