Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE ANALYSIS OF PRECORRIN-8X METHYLMUTASE COMPLEX WITH HYDROGENOBYRINIC ACID
 
Authors :  L. W. Shipman, D. Li, C. A. Roessner, A. I. Scott, J. C. Sacchettini
Date :  01 Feb 01  (Deposition) - 18 Jul 01  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Precorrin, Vitamin B12, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. W. Shipman, D. Li, C. A. Roessner, A. I. Scott, J. C. Sacchettini
Crystal Structure Of Precorrin-8X Methyl Mutase.
Structure V. 9 587 2001
PubMed-ID: 11470433  |  Reference-DOI: 10.1016/S0969-2126(01)00618-9

(-) Compounds

Molecule 1 - PRECORRIN-8X METHYLMUTASE
    Chains: A
    EC Number: 5.4.1.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PLM1
    Expression System Strain: BL(21)DE3
    Expression System Taxid: 469008
    Expression System Vector Type: PET
    Gene: COBH
    Organism Scientific: PSEUDOMONAS DENITRIFICANS
    Organism Taxid: 43306
    Synonym: COBH

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1COJ1Ligand/IonHYDROGENOBYRINIC ACID
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1COJ2Ligand/IonHYDROGENOBYRINIC ACID

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:10 , ILE A:13 , TYR A:14 , SER A:17 , ARG A:40 , HIS A:43 , ALA A:44 , MET A:80 , GLY A:84 , THR A:86 , ARG A:87 , ARG A:101 , THR A:115 , ARG A:116 , SER A:117 , ASN A:137 , ALA A:138 , PRO A:139 , THR A:140 , VAL A:164 , GLY A:165 , PHE A:166 , VAL A:167 , SER A:195 , ALA A:196 , ALA A:199 , ALA A:200 , ASN A:203 , HOH A:1182 , HOH A:1213 , HOH A:1237 , HOH A:1238BINDING SITE FOR RESIDUE COJ A 1121

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1I1H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1I1H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1I1H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1I1H)

(-) Exons   (0, 0)

(no "Exon" information available for 1I1H)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:209
 aligned with COBH_PSEDE | P21638 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:209
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201         
           COBH_PSEDE     2 PEYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKAGAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPTALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL 210
               SCOP domains d1i1ha_ A: Precorrin-8x methylmutase                                                                                                                                                                              SCOP domains
               CATH domains 1i1hA00 A:2-210 Precorrin-8X methylmutase CbiC/CobH                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh..hhhh.eee..hhhhhhhhhh.....eee.hhhhhhhhhhhhh.....ee......hhhhhhhhhh.hhhhhhhhhhh......eeee..hhhhhhhhhhhhhh......eeee......hhhhhhhhhhhh......eee.....hhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1i1h A   2 PEYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKAGAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPTALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL 210
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1I1H)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (COBH_PSEDE | P21638)
molecular function
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0016993    precorrin-8X methylmutase activity    Catalysis of the reaction: precorrin-8X = hydrogenobyrinate.
biological process
    GO:0009236    cobalamin biosynthetic process    The chemical reactions and pathways resulting in the formation of cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    COJ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1i1h)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1i1h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COBH_PSEDE | P21638
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.4.1.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COBH_PSEDE | P21638
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        COBH_PSEDE | P21638: 1f2v

(-) Related Entries Specified in the PDB File

1f2v PRECORRIN-8X METHYLMUTASE