1HYR - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN MICA IN COMPLEX WITH NATURAL KILLER CELL RECEPTOR NKG2D

Authors :   P. Li, R. K. Strong

Date :   21 Jan 01 (Deposition) - 23 May 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Activating Nk Cell Receptor, Nkg2D, C-Type-Lectin Like, Mic- A, Mhc-I, Complex, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Li, D. L. Morris, B. E. Willcox, A. Steinle, T. Spies, R. K. Strong
Complex Structure Of The Activating Immunoreceptor Nkg2D And Its Mhc Class I-Like Ligand Mica.
Nat. Immunol. V. 2 443 2001
PubMed-ID: 11323699
(for further references see the PDB file header)

Molecule 1 - NKG2-D TYPE II INTEGRAL MEMBRANE PROTEIN
	Cellular Location	:	CELL SURFACE
	Chains	:	B, A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET22B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	EXTRACELLULAR DOMAIN (RESIDUES 80 TO 216)
	Gene	:	NKG2D
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	NKG2D

Molecule 2 - MHC CLASS I CHAIN-RELATED PROTEIN A
	Chains	:	C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET11
	Expression System Strain	:	BL21(DE3)RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	EXTRACELLULAR DOMAIN (RESIDUES 1 TO 274)
	Gene	:	MICA-001
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	MIC-A, MIC, PERB11

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1HYR)

(no "Site" information available for 1HYR)

Asymmetric/Biological Unit

No.	Residues
1	A:96	-	A:105
2	A:99	-	A:110
3	A:127	-	A:211
4	A:189	-	A:203
5	B:96	-	B:105
6	B:99	-	B:110
7	B:127	-	B:211
8	B:189	-	B:203
9	C:36	-	C:41
10	C:96	-	C:164
11	C:202	-	C:259

Asymmetric/Biological Unit

No.	Residues
1	Tyr C:208	-	Pro C:209

Asymmetric/Biological Unit (31, 32)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_043625	R	29	P	MICA_HUMAN	Polymorphism	9380254	C	R	6	P
02	UniProt	VAR_043626	W	37	G	MICA_HUMAN	Polymorphism	1063630	C	W	14	G
03	UniProt	VAR_043627	T	47	A	MICA_HUMAN	Polymorphism	1051785	C	T	24	A
04	UniProt	VAR_043628	V	49	G	MICA_HUMAN	Polymorphism	17200158	C	V	26	G
05	UniProt	VAR_043629	C	59	Y	MICA_HUMAN	Polymorphism	1051786	C	C	36	Y
06	UniProt	VAR_043630	Q	114	R	MICA_HUMAN	Polymorphism	41558312	C	Q	91	R
07	UniProt	VAR_043631	R	128	K	MICA_HUMAN	Polymorphism	41557113	C	R	105	K
08	UniProt	VAR_043632	G	137	R	MICA_HUMAN	Polymorphism	41556715	C	G	114	R
09	UniProt	VAR_043633	L	145	V	MICA_HUMAN	Polymorphism	1051790	C	L	122	V
10	UniProt	VAR_043634	T	147	S	MICA_HUMAN	Polymorphism	41539919	C	T	124	S
11	UniProt	VAR_043635	K	148	E	MICA_HUMAN	Polymorphism	1051791	C	K	125	E
12	UniProt	VAR_043636	M	152	V	MICA_HUMAN	Polymorphism	1051792	C	M	129	V
13	UniProt	VAR_043637	V	165	I	MICA_HUMAN	Polymorphism	3819269	C	V	142	I
14	UniProt	VAR_043638	M	174	V	MICA_HUMAN	Polymorphism	41560824	C	M	151	V
15	UniProt	VAR_043639	H	179	L	MICA_HUMAN	Polymorphism	3819268	C	H	156	L
16	UniProt	VAR_043640	K	196	E	MICA_HUMAN	Polymorphism	1051794	C	K	173	E
17	UniProt	VAR_043641	G	198	S	MICA_HUMAN	Polymorphism	1131896	C	G	175	S
18	UniProt	VAR_043642	V	199	I	MICA_HUMAN	Polymorphism	41549718	C	V	176	I
19	UniProt	VAR_030738	N	177	S	NKG2D_HUMAN	Polymorphism	2306182	A/B	N	177	S
20	UniProt	VAR_043643	T	204	R	MICA_HUMAN	Polymorphism	1131897	C	T	181	R
21	UniProt	VAR_043644	G	229	S	MICA_HUMAN	Polymorphism	1131898	C	G	206	S
22	UniProt	VAR_043645	Y	231	C	MICA_HUMAN	Polymorphism	41546915	C	Y	208	C
23	UniProt	VAR_043646	W	233	R	MICA_HUMAN	Polymorphism	1051798	C	W	210	R
24	UniProt	VAR_043647	T	236	I	MICA_HUMAN	Polymorphism	1140700	C	T	213	I
25	UniProt	VAR_043648	S	238	T	MICA_HUMAN	Polymorphism	1051799	C	S	215	T
26	UniProt	VAR_043649	V	244	L	MICA_HUMAN	Polymorphism	41540613	C	V	221	L
27	UniProt	VAR_043869	W	253	S	MICA_HUMAN	Polymorphism	72558175	C	W	230	S
28	UniProt	VAR_043650	Q	274	R	MICA_HUMAN	Polymorphism	1063635	C	Q	251	R
29	UniProt	VAR_043651	R	279	S	MICA_HUMAN	Polymorphism	41557614	C	R	256	S
30	UniProt	VAR_043652	S	291	G	MICA_HUMAN	Polymorphism	61759927	C	S	268	G
31	UniProt	VAR_043653	P	294	A	MICA_HUMAN	Polymorphism	41553616	C	P	271	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	NKG2D_HUMAN	106-212	2	A:106-212 B:106-212

Asymmetric/Biological Unit (8, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000240618	1	ENSE00001524992	chr12:10542640-10542542	99	NKG2D_HUMAN	-	0	0	-	-
1.2	ENST00000240618	2	ENSE00002198225	chr12:10541474-10541370	105	NKG2D_HUMAN	1-14	14	0	-	-
1.3	ENST00000240618	3	ENSE00001656271	chr12:10539609-10539502	108	NKG2D_HUMAN	14-50	37	0	-	-
1.4	ENST00000240618	4	ENSE00001160615	chr12:10532391-10532299	93	NKG2D_HUMAN	50-81	32	0	-	-
1.5	ENST00000240618	5	ENSE00001160608	chr12:10532081-10532046	36	NKG2D_HUMAN	81-93	13	2	A:93-93 B:89-93	1 5
1.6a	ENST00000240618	6a	ENSE00001160601	chr12:10531304-10531153	152	NKG2D_HUMAN	93-143	51	2	A:93-143 B:93-143	51 51
1.7	ENST00000240618	7	ENSE00000821886	chr12:10530834-10530731	104	NKG2D_HUMAN	144-178	35	2	A:144-178 B:144-178	35 35
1.8	ENST00000240618	8	ENSE00001160593	chr12:10525830-10524953	878	NKG2D_HUMAN	178-216	39	2	A:178-216 B:178-216	39 39

2.1c	ENST00000400325	1c	ENSE00001802778	HSCHR6_MHC_QBL:31358575-31358589	15	MICA_HUMAN	-	0	0	-	-
2.2	ENST00000400325	2	ENSE00001765771	HSCHR6_MHC_QBL:31359983-31360182	200	MICA_HUMAN	-	0	0	-	-
2.3a	ENST00000400325	3a	ENSE00001778375	HSCHR6_MHC_QBL:31361271-31361528	258	MICA_HUMAN	1-24	24	1	C:0-1	2
2.4	ENST00000400325	4	ENSE00001751066	HSCHR6_MHC_QBL:31368470-31368724	255	MICA_HUMAN	24-109	86	1	C:1-86	86
2.5b	ENST00000400325	5b	ENSE00001651377	HSCHR6_MHC_QBL:31368999-31369286	288	MICA_HUMAN	109-205	97	1	C:86-182	97
2.6	ENST00000400325	6	ENSE00001666138	HSCHR6_MHC_QBL:31369874-31370152	279	MICA_HUMAN	205-298	94	1	C:182-274	93
2.7	ENST00000400325	7	ENSE00001497291	HSCHR6_MHC_QBL:31370253-31370384	132	MICA_HUMAN	298-342	45	0	-	-
2.8a	ENST00000400325	8a	ENSE00001672548	HSCHR6_MHC_QBL:31372936-31373183	248	MICA_HUMAN	342-383	42	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:124
 aligned with NKG2D_HUMAN | P26718 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:124
                                   102       112       122       132       142       152       162       172       182       192       202       212    
          NKG2D_HUMAN    93 ESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV 216
               SCOP domains d1hyra_ A: NK cell-activating receptor nkg2d                                                                                 SCOP domains
               CATH domains 1hyrA00 A:93-216 Mannose-Binding Protein A, subunit A                                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee...eee..eeeeeeeeeehhhhhhhhhhh...ee........hhhhhh...eeeeeeeee....eeee...........eeee.....eeeee...eeeee.....eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------S--------------------------------------- SAPs(SNPs)
                    PROSITE -------------C_TYPE_LECTIN_2  PDB: A:106-212 UniProt: 106-212                                                           ---- PROSITE
           Transcript 1 (1) 1--------------------------------------------------Exon 1.7  PDB: A:144-178           -------------------------------------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.6a  PDB: A:93-143 UniProt: 93-143           ----------------------------------Exon 1.8  PDB: A:178-216                Transcript 1 (2)
                 1hyr A  93 ESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV 216
                                   102       112       122       132       142       152       162       172       182       192       202       212

Chain B from PDB  Type:PROTEIN  Length:128
 aligned with NKG2D_HUMAN | P26718 from UniProtKB/Swiss-Prot  Length:216

    Alignment length:128
                                    98       108       118       128       138       148       158       168       178       188       198       208        
          NKG2D_HUMAN    89 IPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV 216
               SCOP domains d1hyrb_ B: NK cell-activating receptor nkg2d                                                                                     SCOP domains
               CATH domains 1hyrB00 B:89-216 Mannose-Binding Protein A, subunit A                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.......ee....eeeeeeeeehhhhhhhhhhh...ee........hhhhhh....ee...ee......ee............eee......eeeee...eeeee.....eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------S--------------------------------------- SAPs(SNPs)
                    PROSITE -----------------C_TYPE_LECTIN_2  PDB: B:106-212 UniProt: 106-212                                                           ---- PROSITE
           Transcript 1 (1) 1.5  --------------------------------------------------Exon 1.7  PDB: B:144-178           -------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.6a  PDB: B:93-143 UniProt: 93-143           ----------------------------------Exon 1.8  PDB: B:178-216                Transcript 1 (2)
                 1hyr B  89 IPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV 216
                                    98       108       118       128       138       148       158       168       178       188       198       208

Chain C from PDB  Type:PROTEIN  Length:275
 aligned with MICA_HUMAN | Q29983 from UniProtKB/Swiss-Prot  Length:383

    Alignment length:275
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292     
           MICA_HUMAN    23 AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS 297
               SCOP domains d1hyrc2 C:0-180 Class I MHC homolog                                                                                                                                                  d1hyrc1 C:181-274 Class I MHC homolog, alpha-3 domain                                          SCOP domains
               CATH domains -1hyrC01 C:1-180 Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1                                                                                         1hyrC02 C:181-273 Immunoglobulins                                                            - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeeee..eeeeeeeeeeee..eeeeee....eee...........hhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeeeee.....eeeeeeeee..eeeeeee....eee...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..........eeeeee......eeeeeeeeeee.....eeeeee..ee......ee...ee.....eeeeeeeeee..hhh.eeeeeee..eeeeee... Sec.struct. author
                 SAPs(SNPs) ------P-------G---------A-G---------Y------------------------------------------------------R-------------K--------R-------V-SE---V------------I--------V----L----------------E-SI----R------------------------S-C-R--I-T-----L--------S--------------------R----S-----------G--A--- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) 2.------------------------------------------------------------------------------------Exon 2.5b  PDB: C:86-182 UniProt: 109-205                                                        -------------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) -Exon 2.4  PDB: C:1-86 UniProt: 24-109                                                 -----------------------------------------------------------------------------------------------Exon 2.6  PDB: C:182-274 UniProt: 205-298 [INCOMPLETE]                                        Transcript 2 (2)
                 1hyr C   0 MEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS 274
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 1HYR)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (NKG2D_HUMAN | P26718)

molecular function
	GO:0042288	MHC class I protein binding	Interacting selectively and non-covalently with major histocompatibility complex class I molecules; a set of molecules displayed on cell surfaces that are responsible for lymphocyte recognition and antigen presentation.
	GO:0032394	MHC class Ib receptor activity	Combining with an MHC class Ib protein complex and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity. Class Ib here refers to non-classical class I molecules, such as those of the CD1 or HLA-E gene families.
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0019900	kinase binding	Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
biological process
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0050830	defense response to Gram-positive bacterium	Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0030101	natural killer cell activation	The change in morphology and behavior of a natural killer cell in response to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0034260	negative regulation of GTPase activity	Any process that stops or reduces the rate of GTP hydrolysis by a GTPase.
	GO:2000502	negative regulation of natural killer cell chemotaxis	Any process that stops, prevents or reduces the frequency, rate or extent of natural killer cell chemotaxis.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0032729	positive regulation of interferon-gamma production	Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0030887	positive regulation of myeloid dendritic cell activation	Any process that stimulates, induces or increases the rate of myeloid dendritic cell activation.
	GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	Any process that activates or increases the frequency, rate or extent of natural killer cell mediated cytotoxicity.
	GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	Any process that activates or increases the frequency, rate, or extent of natural killer cell mediated cytotoxicity directed against tumor cell target.
	GO:0045429	positive regulation of nitric oxide biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of nitric oxide.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0002223	stimulatory C-type lectin receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain C (MICA_HUMAN | Q29983)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0030881	beta-2-microglobulin binding	Interacting selectively and non-covalently with beta-2-microglobulin.
	GO:0046703	natural killer cell lectin-like receptor binding	Interacting selectively and non-covalently with a lectin-like natural killer cell receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0001913	T cell mediated cytotoxicity	The directed killing of a target cell by a T cell through the release of granules containing cytotoxic mediators or through the engagement of death receptors.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0019835	cytolysis	The rupture of cell membranes and the loss of cytoplasm.
	GO:0042742	defense response to bacterium	Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0046629	gamma-delta T cell activation	The change in morphology and behavior of a gamma-delta T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002418	immune response to tumor cell	An immune system process that functions in the response of an organism to a tumor cell.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0042267	natural killer cell mediated cytotoxicity	The directed killing of a target cell by a natural killer cell through the release of granules containing cytotoxic mediators or through the engagement of death receptors.
	GO:0032815	negative regulation of natural killer cell activation	Any process that stops, prevents, or reduces the frequency, rate or extent of natural killer cell activation.
	GO:0045953	negative regulation of natural killer cell mediated cytotoxicity	Any process that stops, prevents, or reduces the rate of natural killer mediated cytotoxicity.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0009408	response to heat	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hyr)

	Sites
(no "Sites" information available for 1hyr)

	Cis Peptide Bonds
		Tyr C:208 - Pro C:209	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1hyr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MICA_HUMAN \| Q29983
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NKG2D_HUMAN \| P26718
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MICA_HUMAN \| Q29983
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NKG2D_HUMAN \| P26718
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MICA_HUMAN \| Q29983	:	1b3j
	NKG2D_HUMAN \| P26718	:	1kcg 1mpu 4pdc 4s0u

(no "Related Entries Specified in the PDB File" available for 1HYR)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (11, 11)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (31, 32)

PROSITE Motifs (1, 2)

Exons (8, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 4)

CATH Domains (3, 4)

Pfam Domains (0, 0)

Gene Ontology (51, 60)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File