|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 10)
Asymmetric Unit (1, 10)
|
Sites (0, 0)| (no "Site" information available for 1HY5) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1HY5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1HY5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1HY5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1HY5) |
Exons (0, 0)| (no "Exon" information available for 1HY5) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:120 aligned with YOPE_YERPE | P31493 from UniProtKB/Swiss-Prot Length:219 Alignment length:120 109 119 129 139 149 159 169 179 189 199 209 219 YOPE_YERPE 100 TSFSDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM 219 SCOP domains d1hy5a_ A: YopE SCOP domains CATH domains 1hy5A00 A:1100-1218 [code=1.20.120.260, no name defined] - CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 1hy5 A 1100 TSFSDSIKQLAAETLPKYmQQLNSLDAEmLQKNHDQFATGSGPLRGSITQCQGLmQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQmQKLLSLm 1219 1109 1119 1129 1139 1149 | 1159 1169 1179 1189 1199 1209 | 1219 1118-MSE 1128-MSE 1154-MSE 1212-MSE | 1219-MSE Chain B from PDB Type:PROTEIN Length:121 aligned with YOPE_YERPE | P31493 from UniProtKB/Swiss-Prot Length:219 Alignment length:121 219 109 119 129 139 149 159 169 179 189 199 209 219 YOPE_YERPE 100 TSFSDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM- - SCOP domains d1hy5b_ B: YopE SCOP domains CATH domains 1hy5B00 B:2100-2220 [code=1.20.120.260, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1hy5 B 2100 TSFSDSIKQLAAETLPKYmQQLNSLDAEmLQKNHDQFATGSGPLRGSITQCQGLmQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQmQKLLSLmH 2220 2109 2119 2129 2139 2149 | 2159 2169 2179 2189 2199 2209 | 2219 2118-MSE 2128-MSE 2154-MSE 2212-MSE | 2219-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1HY5) |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A,B (YOPE_YERPE | P31493)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|