Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  PPIASE DOMAIN OF THE MYCOPLASMA GENITALIUM TRIGGER FACTOR
 
Authors :  M. Vogtherr, T. N. Parac, M. Maurer, A. Pahl, K. Fiebig
Date :  17 Jan 01  (Deposition) - 29 May 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (12x)
Keywords :  Fkbp Fold, Ppiase, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Vogtherr, D. M. Jacobs, T. N. Parac, M. Maurer, A. Pahl, K. Saxena, H. Ruterjans, C. Griesinger, K. M. Fiebig
Nmr Solution Structure And Dynamics Of The Peptidyl-Prolyl Cis-Trans Isomerase Domain Of The Trigger Factor From Mycoplasma Genitalium Compared To Fk506-Binding Protein.
J. Mol. Biol. V. 318 1097 2002
PubMed-ID: 12054805  |  Reference-DOI: 10.1016/S0022-2836(02)00112-2
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRIGGER FACTOR
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PQE30
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: PPIASE DOMAIN (RESIDUES 150-250)
    Organism Scientific: MYCOPLASMA GENITALIUM
    Organism Taxid: 2097

 Structural Features

(-) Chains, Units

  
NMR Structure (12x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1HXV)

(-) Sites  (0, 0)

(no "Site" information available for 1HXV)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1HXV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1HXV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1HXV)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FKBP_PPIASEPS50059 FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.TIG_MYCGE170-230  1A:33-93

(-) Exons   (0, 0)

(no "Exon" information available for 1HXV)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:85
 aligned with TIG_MYCGE | P47480 from UniProtKB/Swiss-Prot  Length:444

    Alignment length:85
                                   175       185       195       205       215       225       235       245     
            TIG_MYCGE   166 KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK 250
               SCOP domains d1hxva_ A: Trigger factor PPIase domain                                               SCOP domains
               CATH domains 1hxvA00 A:29-113  [code=3.10.50.40, no name defined]                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee..ee.......eeeeee.......hhhhhhhh....eeeee..........hhhhh...eeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----FKBP_PPIASE  PDB: A:33-93 UniProt: 170-230                   -------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 1hxv A  29 KLANGDIAIIDFTGIVDNKKLASASAQNYELTIGSNSFIKGFETGLIAMKVNQKKTLALTFPSDYHVKELQSKPVTFEVVLKAIK 113
                                    38        48        58        68        78        88        98       108
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HXV)

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (TIG_MYCGE | P47480)
molecular function
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0003755    peptidyl-prolyl cis-trans isomerase activity    Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0000413    protein peptidyl-prolyl isomerization    The modification of a protein by cis-trans isomerization of a proline residue.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hxv)
 
  Sites
(no "Sites" information available for 1hxv)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1hxv)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1hxv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TIG_MYCGE | P47480
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TIG_MYCGE | P47480
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1HXV)

(-) Related Entries Specified in the PDB File

4953 4953 IS THE BMRB ENTRY CORRESPONDING TO THE NMR DATA FOR THIS PROTEIN