|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric/Biological Unit (2, 5) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1HXI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1HXI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1HXI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1HXI) |
Exons (0, 0)| (no "Exon" information available for 1HXI) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:112 aligned with Q9U763_TRYBB | Q9U763 from UniProtKB/TrEMBL Length:463 Alignment length:273 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 253 263 273 283 293 303 Q9U763_TRYBB 34 SNYDYFSEYYKFAQRNADAISSNPSFWKHMFTYYNVVVFTMQVLLEAFMLTPLGRRIPISWRLIFGLTIPMVEIIVILVIPEVGGSEDGAIATMMIVAFVGGISKTLCDSSNAALAGPFPTKFYGAIVWGLAVSGLMTSFMSIVIKASMDSSFESKRVQSQIYFGLVMLLQVVACVLLFLLRKNPYAIKYAAEFRYAARKDGKTDDGEDENDAKGTGPADEDGYPDEKENKNVLNADIDPDKMKDTDQVEGTTNAQQMLDASVMVVVKRIWPM 306 SCOP domains d1hxia _ A: Peroxin pex5 (peroxis omal t argetin g signal 1 (PT S1) receptor) SCOP domains CATH domains 1hxiA0 0 A:334-445 [code=1.25.40 .10, n o name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains Chain A from PDB Type:PROTEIN Length:112 aligned with Q9U7C3_9TRYP | Q9U7C3 from UniProtKB/TrEMBL Length:655 Alignment length:112 343 353 363 373 383 393 403 413 423 433 443 Q9U7C3_9TRYP 334 NNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLL 445 SCOP domains d1hxia_ A: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) SCOP domains CATH domains 1hxiA00 A:334-445 [code=1.25.40.10, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------- Transcript 1hxi A 334 NNTDYPFEANNPYmYHENPmEEGLSmLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARmLDPKDIAVHAALAVSHTNEHNANAALASLRAWLL 445 343 | 353 | 363 373 383 393 403 413 423 433 443 347-MSE | | 411-MSE 353-MSE | 359-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1HXI) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9U763_TRYBB | Q9U763)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|