1HX0 - JenaLib

Asymmetric Unit (23, 23)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	TRP A:59 , TYR A:62 , GLN A:63 , HIS A:305 , AC1 A:1990 , AC1 A:1992	BINDING SITE FOR RESIDUE GLC A 1991
02	AC2	SOFTWARE	TRP A:59 , GLN A:63 , GLY A:104 , SER A:105 , GLY A:106 , VAL A:163 , GLY A:164 , GLC A:1991 , HOH A:6307 , HOH A:6608 , HOH A:6864	BINDING SITE FOR RESIDUE AC1 A 1990
03	AC3	SOFTWARE	TRP A:58 , TYR A:62 , HIS A:101 , ARG A:195 , ASP A:197 , ALA A:198 , HIS A:201 , GLU A:233 , HIS A:299 , ASP A:300 , GLC A:1991 , GLC A:1993 , BGC A:2993 , HOH A:6570 , HOH A:6610	BINDING SITE FOR RESIDUE AC1 A 1992
04	AC4	SOFTWARE	TYR A:151 , LYS A:200 , ILE A:235 , GLU A:240 , ALA A:307 , AC1 A:1992 , HOH A:6380 , HOH A:6538	BINDING SITE FOR RESIDUE GLC A 1993
05	AC5	SOFTWARE	TYR A:151 , LYS A:200 , ILE A:235 , GLU A:240 , GLY A:306 , AC1 A:1992 , HOH A:6283 , HOH A:6378 , HOH A:6380	BINDING SITE FOR RESIDUE BGC A 2993
06	AC6	SOFTWARE	THR A:52 , ASN A:53 , SER A:55 , LYS A:261 , GLU A:272 , TYR A:276 , ASN A:279 , TRP A:284 , EDO A:5013 , HOH A:6411 , HOH A:6462 , HOH A:6662 , HOH A:6684 , HOH A:6961	BINDING SITE FOR RESIDUE MAL A 1994
07	AC7	SOFTWARE	ARG A:195 , ASN A:298 , ARG A:337	BINDING SITE FOR RESIDUE CL A 498
08	AC8	SOFTWARE	PRO A:204 , GLY A:205	BINDING SITE FOR RESIDUE CL A 499
09	AC9	SOFTWARE	ASN A:137 , LYS A:140 , ALA A:169 , LEU A:170 , GLU A:171 , HOH A:6720	BINDING SITE FOR RESIDUE CL A 501
10	BC1	SOFTWARE	ASN A:216 , GLY A:225 , SER A:437 , SER A:478 , HOH A:6309	BINDING SITE FOR RESIDUE CL A 502
11	BC2	SOFTWARE	ASN A:100 , ARG A:158 , ASP A:167 , HIS A:201 , HOH A:6017 , HOH A:6023 , HOH A:6031	BINDING SITE FOR RESIDUE CA A 500
12	BC3	SOFTWARE	ARG A:30 , THR A:376 , ARG A:387 , HOH A:6157 , HOH A:6294	BINDING SITE FOR RESIDUE EDO A 5000
13	BC4	SOFTWARE	LYS A:466 , VAL A:467 , GLN A:476 , PHE A:477 , SER A:478 , EDO A:5004 , HOH A:6367	BINDING SITE FOR RESIDUE EDO A 5001
14	BC5	SOFTWARE	ILE A:49 , VAL A:50 , ALA A:108 , ALA A:109 , GLY A:110 , THR A:111 , GLY A:112 , HOH A:6269 , HOH A:6548 , HOH A:6557	BINDING SITE FOR RESIDUE EDO A 5002
15	BC6	SOFTWARE	LYS A:322 , TRP A:388 , GLU A:390 , HOH A:6340	BINDING SITE FOR RESIDUE EDO A 5003
16	BC7	SOFTWARE	LYS A:213 , LEU A:214 , HIS A:215 , LYS A:466 , VAL A:467 , TYR A:468 , EDO A:5001 , HOH A:6291 , HOH A:6367	BINDING SITE FOR RESIDUE EDO A 5004
17	BC8	SOFTWARE	ASN A:301 , GLN A:302 , SER A:310 , ILE A:312 , HOH A:6688 , HOH A:6689 , HOH A:6724	BINDING SITE FOR RESIDUE EDO A 5005
18	BC9	SOFTWARE	ARG A:319 , LYS A:322 , GLU A:484 , ASP A:485 , HOH A:6770	BINDING SITE FOR RESIDUE EDO A 5006
19	CC1	SOFTWARE	ARG A:343 , ILE A:358 , GLY A:359 , PRO A:360 , PRO A:361 , ASP A:381 , HOH A:6165 , HOH A:6317 , HOH A:6591	BINDING SITE FOR RESIDUE EDO A 5007
20	CC2	SOFTWARE	ARG A:20 , SER A:73 , HOH A:6233 , HOH A:6713 , HOH A:6753	BINDING SITE FOR RESIDUE EDO A 5008
21	CC3	SOFTWARE	PCA A:1 , LEU A:211 , ARG A:227 , PRO A:228 , ILE A:230 , HOH A:6935	BINDING SITE FOR RESIDUE EDO A 5010
22	CC4	SOFTWARE	TYR A:276 , MAL A:1994 , HOH A:6362 , HOH A:6462 , HOH A:6616 , HOH A:6684 , HOH A:6685	BINDING SITE FOR RESIDUE EDO A 5013
23	CC5	SOFTWARE	ASN A:218 , SER A:437 , SER A:438 , THR A:439 , GLN A:476 , HOH A:6077 , HOH A:6113	BINDING SITE FOR RESIDUE EDO A 5014

SS Bonds (5, 5)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:496
 aligned with AMYP_PIG | P00690 from UniProtKB/Swiss-Prot  Length:511

    Alignment length:496
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505      
             AMYP_PIG    16 QYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWANGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL 511
               SCOP domains d1hx0a2 A:1-403 Animal alpha-amylase                                                                                                                                                                                                                                                                                                                                                                               d1hx0a1 A:404-496 Animal alpha-amylase                                                        SCOP domains
               CATH domains -1hx0A01 A:2-403 Glycosidases                                                                                                                                                                                                                                                                                                                                                                                      1hx0A02 A:404-496 Golgi alpha-mannosidase II                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeee...hhhhhhhhhhhh.......eeee..............hhhhhhh...........hhhhhhhhhhhhhhh..eeeeee...eeee...............hhhhh.......hhhhh................hhhhhhhh....eee....hhhhhhhhhhhhhhhhhhh..eeee.hhhhhhhhhhhhhhh................eeee..........hhhhhh...eee.hhhhhhhhhhhh.....hhhhhhhhhhhhh..hhh.eee.....hhhhh...hhhhh.hhhhhhhhhhhhhhhhhh...eeeeee.......ee..ee........ee..ee................hhhhhhhhhhhhhhhhhh....eeeeee....eeeeee...eeeeee.....eeeeee.....eeee......ee..ee...eeee....eeeeee.......eeeee.hhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hx0 A   1 xYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKIAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL 496
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490      
                            |                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               
                            1-PCA

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (AMYP_PIG | P00690)

molecular function
	GO:0004556	alpha-amylase activity	Catalysis of the endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more alpha-(1->4)-linked D-glucose units.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0043169	cation binding	Interacting selectively and non-covalently with cations, charged atoms or groups of atoms with a net positive charge.
	GO:0031404	chloride ion binding	Interacting selectively and non-covalently with chloride ions (Cl-).
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016798	hydrolase activity, acting on glycosyl bonds	Catalysis of the hydrolysis of any glycosyl bond.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0016052	carbohydrate catabolic process	The chemical reactions and pathways resulting in the breakdown of carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AC1	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		BGC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GLC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MAL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PCA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		CC1	[ RasMol ]	+environment [ RasMol ]
		CC2	[ RasMol ]	+environment [ RasMol ]
		CC3	[ RasMol ]	+environment [ RasMol ]
		CC4	[ RasMol ]	+environment [ RasMol ]
		CC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:53 - Pro A:54	[ RasMol ]
		Val A:129 - Pro A:130	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1hx0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AMYP_PIG \| P00690
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.2.1.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (8, 24)

Sites (23, 23)