![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 1HTP) |
(no "Cis Peptide Bond" information available for 1HTP) |
(no "SAP(SNP)/Variant" information available for 1HTP) |
Asymmetric/Biological Unit (2, 2) |
(no "Exon" information available for 1HTP) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:131 aligned with GCSH_PEA | P16048 from UniProtKB/Swiss-Prot Length:165 Alignment length:131 44 54 64 74 84 94 104 114 124 134 144 154 164 GCSH_PEA 35 SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH 165 SCOP domains d1htpa_ A: Protein H of glycine cleavage system SCOP domains CATH domains 1htpA00 A:1-131 [code=2.40.50.100, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------------------BIOTINYL_LIPOYL PDB: A:22-104 UniProt: 56-138 --------------------------- PROSITE (1) PROSITE (2) ----------------------------------------------LIPOYL PDB: A:47-76 ------------------------------------------------------- PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1htp A 1 SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH 131 10 20 30 40 50 60 70 80 90 100 110 120 130
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1HTP) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A (GCSH_PEA | P16048)
|
|
|
|
|
|
|