1HPT - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   THREE-DIMENSIONAL STRUCTURE OF A RECOMBINANT VARIANT OF HUMAN PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE)

Authors :   H. J. Hecht, M. Szardenings, J. Collins, D. Schomburg

Date :   27 Mar 92 (Deposition) - 31 Oct 93 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A

Keywords :   Serine Protease Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. J. Hecht, M. Szardenings, J. Collins, D. Schomburg
Three-Dimensional Structure Of A Recombinant Variant Of Human Pancreatic Secretory Trypsin Inhibitor (Kazal Type).
J. Mol. Biol. V. 225 1095 1992
PubMed-ID: 1613792 | Reference-DOI: 10.1016/0022-2836(92)90107-U
(for further references see the PDB file header)

Molecule 1 - PANCREATIC SECRETORY TRYPSIN INHIBITOR (KAZAL TYPE) VARIANT 3
	Chains	:	A
	Engineered	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1HPT)

(no "Site" information available for 1HPT)

Asymmetric/Biological Unit

No.	Residues
1	A:9	-	A:38
2	A:16	-	A:35
3	A:24	-	A:56

(no "Cis Peptide Bond" information available for 1HPT)

Asymmetric/Biological Unit (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_011689	N	34	S	ISK1_HUMAN	Disease (TCP)	17107315	A	N	11	S
2	UniProt	VAR_011690	P	55	S	ISK1_HUMAN	Polymorphism	111966833	A	P	32	S
3	UniProt	VAR_032012	R	67	H	ISK1_HUMAN	Polymorphism	35523678	A	R	44	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	KAZAL_2	PS51465	Kazal domain profile.	ISK1_HUMAN	26-79	1	A:3-56
2	KAZAL_1	PS00282	Kazal serine protease inhibitors family signature.	ISK1_HUMAN	39-61	1	A:16-38

Asymmetric/Biological Unit (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000296695	1a	ENSE00001082883	chr5:147211349-147211086	264	ISK1_HUMAN	1-19	19	0	-	-
1.2	ENST00000296695	2	ENSE00001082880	chr5:147209193-147209162	32	ISK1_HUMAN	19-29	11	1	A:1-6	6
1.3b	ENST00000296695	3b	ENSE00001082882	chr5:147207691-147207585	107	ISK1_HUMAN	30-65	36	1	A:7-42	36
1.4b	ENST00000296695	4b	ENSE00002081650	chr5:147204269-147204131	139	ISK1_HUMAN	65-79	15	1	A:42-56	15

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:56
 aligned with ISK1_HUMAN | P00995 from UniProtKB/Swiss-Prot  Length:79

    Alignment length:56
                                    33        43        53        63        73      
            ISK1_HUMAN   24 DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC 79
               SCOP domains d1hpta_ A: Secretory trypsin inhibitor                   SCOP domains
               CATH domains 1hptA00 A:1-56  [code=3.30.60.30, no name defined]       CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ......................eee....ee..hhhhhhhhhhh.....eeee... Sec.struct. author
                 SAPs(SNPs) ----------S--------------------S-----------H------------ SAPs(SNPs)
                PROSITE (1) --KAZAL_2  PDB: A:3-56 UniProt: 26-79                    PROSITE (1)
                PROSITE (2) ---------------KAZAL_1  PDB: A:16-38  ------------------ PROSITE (2)
           Transcript 1 (1) 1.2   Exon 1.3b  PDB: A:7-42              -------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.4b       Transcript 1 (2)
                  1hpt A  1 DSLGREAKCYNELNGCTYEYRPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC 56
                                    10        20        30        40        50

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: Kazal-type serine protease inhibitors (75)

Superfamily: Kazal-type serine protease inhibitors (75)

Family: Ovomucoid domain III-like (69)

Protein domain: Secretory trypsin inhibitor (4)

Human (Homo sapiens) [TaxId: 9606] (3)

d1hpta_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Wheat Germ Agglutinin (Isolectin 2); domain 1 (140)

Homologous Superfamily: [code=3.30.60.30, no name defined] (93)

Human (Homo sapiens) (13)

1hptA00

A:1-56

(no "Pfam Domain" information available for 1HPT)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ISK1_HUMAN | P00995)

molecular function
	GO:0004866	endopeptidase inhibitor activity	Stops, prevents or reduces the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0090281	negative regulation of calcium ion import	Any process that decreases the rate, frequency, or extent of the directed movement of calcium ions into a cell or organelle.
	GO:0010751	negative regulation of nitric oxide mediated signal transduction	Any process that decreases the rate, frequency or extent of nitric oxide mediated signal transduction. Nitric oxide mediated signal transduction is a series of molecular signals mediated by the detection of nitric oxide (NO).
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
	GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:1900004	negative regulation of serine-type endopeptidase activity	Any process that stops, prevents or reduces the frequency, rate or extent of serine-type endopeptidase activity.
	GO:0060046	regulation of acrosome reaction	Any process that modulates the frequency, rate or extent of the acrosome reaction.
	GO:2001256	regulation of store-operated calcium entry	Any process that modulates the frequency, rate or extent of store-operated calcium entry.
cellular component
	GO:0001669	acrosomal vesicle	A structure in the head of a spermatozoon that contains acid hydrolases, and is concerned with the breakdown of the outer membrane of the ovum during fertilization. It lies just beneath the plasma membrane and is derived from the lysosome.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hpt)

	Sites
(no "Sites" information available for 1hpt)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1hpt)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Midas
	spacefill, water [ mono GIF format \| stereo GIF format ]
Setor
	ribbon, SS bonds, labeling [ mono GIF format \| stereo GIF format ]

Access by PDB/NDB ID
	1hpt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ISK1_HUMAN \| P00995
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	608189
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ISK1_HUMAN \| P00995
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ISK1_HUMAN \| P00995	:	1cgi 1cgj

(no "Related Entries Specified in the PDB File" available for 1HPT)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (2, 2)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File