|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 8) |
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 1HLQ) |
(no "Cis Peptide Bond" information available for 1HLQ) |
(no "SAP(SNP)/Variant" information available for 1HLQ) |
Asymmetric/Biological Unit (1, 2) |
(no "Exon" information available for 1HLQ) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:75 aligned with HIP_RHOFE | P80882 from UniProtKB/Swiss-Prot Length:75 Alignment length:75 10 20 30 40 50 60 70 HIP_RHOFE 1 AAPLVAETDANAKSLGYVADTTKADKTKYPKHTKDQSCSTCALYQGKTAPQGACPLFAGKEVVAKGWCSAWAKKA 75 SCOP domains d1hlqa_ A: HIPIP (high potential iron protein) SCOP domains CATH domains 1hlqA00 A:1-75 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains --------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: A:1-75 UniProt: 1-75 PROSITE Transcript --------------------------------------------------------------------------- Transcript 1hlq A 1 AAPLVAETDANAKSLGYVADTTKADKTKYPKHTKDQSCSTCALYQGKTAPQGACPLFAGKEVVAKGWCSAWAKKA 75 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:74 aligned with HIP_RHOFE | P80882 from UniProtKB/Swiss-Prot Length:75 Alignment length:74 11 21 31 41 51 61 71 HIP_RHOFE 2 APLVAETDANAKSLGYVADTTKADKTKYPKHTKDQSCSTCALYQGKTAPQGACPLFAGKEVVAKGWCSAWAKKA 75 SCOP domains d1hlqb_ B: HIPIP (high potential iron protein) SCOP domains CATH domains 1hlqB00 B:2-75 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: - UniProt: 1-75 PROSITE Transcript -------------------------------------------------------------------------- Transcript 1hlq B 2 APLVAETDANAKSLGYVADTTKADKTKYPKHTKDQSCSTCALYQGKTAPQGACPLFAGKEVVAKGWCSAWAKKA 75 11 21 31 41 51 61 71 Chain C from PDB Type:PROTEIN Length:74 aligned with HIP_RHOFE | P80882 from UniProtKB/Swiss-Prot Length:75 Alignment length:74 10 20 30 40 50 60 70 HIP_RHOFE 1 AAPLVAETDANAKSLGYVADTTKADKTKYPKHTKDQSCSTCALYQGKTAPQGACPLFAGKEVVAKGWCSAWAKK 74 SCOP domains d1hlqc_ C: HIPIP (high potential iron protein) SCOP domains CATH domains 1hlqC00 C:1-74 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: C:1-74 UniProt: 1-75 PROSITE Transcript -------------------------------------------------------------------------- Transcript 1hlq C 1 AAPLVAETDANAKSLGYVADTTKADKTKYPKHTKDQSCSTCALYQGKTAPQGACPLFAGKEVVAKGWCSAWAKK 74 10 20 30 40 50 60 70
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1HLQ) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B,C (HIP_RHOFE | P80882)
|
|
|
|
|
|
|