1HL6 - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:119
 aligned with RBM8A_DROME | Q9V535 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:143
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149   
          RBM8A_DROME    10 AEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVK 152
               SCOP domains d1hl6a_ A: RNA-binding protein                         8                                                                                        SCOP domains
               CATH domains 1hl6A00 A:10-152  [code=3.30.7                        0.330, no name defined]                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhh..eeehhhhh------------------------.........eeeeee......hhhhhhhhhhh...eeeee.............eeeee.hhhhhhhhhhhhh..ee..ee.eeee.ee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------RRM  PDB: A:73-151 UniProt: 73-151                                             - PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hl6 A  10 AEEFEVDEDGDQGIVRLKEKAKHRKGRGFG------------------------PGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVK 152
                                    19        29        39         -         -    |   69        79        89        99       109       119       129       139       149   
                                                        39                       64

Chain B from PDB  Type:PROTEIN  Length:137
 aligned with MGN_DROME | P49028 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:143
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143   
            MGN_DROME     4 EDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKP 146
               SCOP domains d1hl6b_ B: Mago nashi protein                                                                                                                   SCOP domains
               CATH domains 1hl6B00 B:4-146 Mago nashi protein                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeee..eeeeeeeee....eeeeeee..----.eeeeeeeehhhhhhhhhhhhhhhhhhhh............eeeeeeee..eeeeeee...--hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hl6 B   4 EDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSN----TMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKT--LVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKP 146
                                    13        23        33      |  - |      53        63        73        83        93       103 |  |  113       123       133       143   
                                                               40   45                                                         105  |                                      
                                                                                                                                  108

Chain C from PDB  Type:PROTEIN  Length:111
 aligned with RBM8A_DROME | Q9V535 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:141
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151 
          RBM8A_DROME    12 EFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVK 152
               SCOP domains d1hl6c_ C: RNA-binding prot                         ein 8                                                                                     SCOP domains
               CATH domains 1hl6C00 C:12-152  [code=3.3                         0.70.330, no name defined]                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhh..eee....-------------------------.........eeeeee......hhhhhhhhhhhhh.eeeee...-----.....eeeee.hhhhhhhhhhhhh..ee..ee.eeee.ee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------RRM  PDB: C:73-151 UniProt: 73-151                                             - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hl6 C  12 EFEVDEDGDQGIVRLKEKAKHRKGRGF-------------------------PGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNL-----FSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVK 152
                                    21        31      |  -         -         -  |     71        81        91       101    |    -|      121       131       141       151 
                                                     38                        64                                       106   112

Chain D from PDB  Type:PROTEIN  Length:143
 aligned with MGN_DROME | P49028 from UniProtKB/Swiss-Prot  Length:147

    Alignment length:145
                                                                                                                                                                        147  
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144  |  
            MGN_DROME     5 DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI--   -
               SCOP domains d1hl6d_ D:   Mago nashi protein                                                                                                                   SCOP domains
               CATH domains 1hl6D00 D:5  -149 Mago nashi protein                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee.--...eeeeeee....eeeeeee........eeeeeeehhhhhhhhhhhhhhhhhhhh............eeeeeeee..eeeeeee....hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1hl6 D   5 DFYLRYYVGHK--FGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPIPR 149
                                    14|  |    24        34        44        54        64        74        84        94       104       114       124       134       144     
                                     15 18

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,C (RBM8A_DROME | Q9V535)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003729	mRNA binding	Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006396	RNA processing	Any process involved in the conversion of one or more primary RNA transcripts into one or more mature RNA molecules.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0046595	establishment of pole plasm mRNA localization	Any process that results in the directed movement of mRNA to the oocyte pole plasm.
	GO:0007294	germarium-derived oocyte fate determination	The cell fate determination process in which a germarium-derived cell becomes capable of differentiating autonomously into an oocyte cell regardless of its environment; upon determination, the cell fate cannot be reversed. An example of this is found in Drosophila melanogaster.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0000226	microtubule cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising microtubules and their associated proteins.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0000335	negative regulation of transposition, DNA-mediated	Any process that stops, prevents, or reduces the frequency, rate or extent of DNA transposition.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
	GO:0007314	oocyte anterior/posterior axis specification	Polarization of the oocyte along its anterior-posterior axis. An example of this is found in Drosophila melanogaster.
	GO:0007310	oocyte dorsal/ventral axis specification	The establishment, maintenance and elaboration of the dorsal/ventral axis of the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0007312	oocyte nucleus migration involved in oocyte dorsal/ventral axis specification	The directed movement of the oocyte nucleus within the cell as part of the establishment and maintenance of the dorsal/ventral axis of the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0045451	pole plasm oskar mRNA localization	Any process in which oskar mRNA is transported to, or maintained in, the oocyte pole plasm.
	GO:0000381	regulation of alternative mRNA splicing, via spliceosome	Any process that modulates the frequency, rate or extent of alternative splicing of nuclear mRNAs.
	GO:0007317	regulation of pole plasm oskar mRNA localization	Any process that modulates the frequency, rate or extent of the process in which oskar mRNA is transported to, or maintained in, the oocyte pole plasm.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0071013	catalytic step 2 spliceosome	A spliceosomal complex that contains three snRNPs, including U5, bound to a splicing intermediate in which the first catalytic cleavage of the 5' splice site has occurred. The precise subunit composition differs significantly from that of the catalytic step 1, or activated, spliceosome, and includes many proteins in addition to those found in the associated snRNPs.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0035145	exon-exon junction complex	A multi-subunit complex deposited by the spliceosome upstream of messenger RNA exon-exon junctions. The exon-exon junction complex provides a binding platform for factors involved in mRNA export and nonsense-mediated mRNA decay.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D (MGN_DROME | P49028)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0046594	maintenance of pole plasm mRNA location	The process of maintaining mRNA in a specific location in the oocyte pole plasm. An example of this process is found in Drosophila melanogaster.
	GO:0000226	microtubule cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising microtubules and their associated proteins.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0000335	negative regulation of transposition, DNA-mediated	Any process that stops, prevents, or reduces the frequency, rate or extent of DNA transposition.
	GO:0007309	oocyte axis specification	The establishment, maintenance and elaboration of an axis in the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0016325	oocyte microtubule cytoskeleton organization	Formation and maintenance of a polarized microtubule array originating from a microtubule-organizing center (MTOC) in the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0008103	oocyte microtubule cytoskeleton polarization	Establishment and maintenance of a specific axis of polarity of the oocyte microtubule network. The axis is set so that the minus and plus ends of the microtubules of the mid stage oocyte are positioned along the anterior cortex and at the posterior pole, respectively. An example of this is found in Drosophila melanogaster.
	GO:0048477	oogenesis	The complete process of formation and maturation of an ovum or female gamete from a primordial female germ cell. Examples of this process are found in Mus musculus and Drosophila melanogaster.
	GO:0007315	pole plasm assembly	Establishment of the specialized cytoplasm found at the poles of the egg. An example of this is found in Drosophila melanogaster.
	GO:0045451	pole plasm oskar mRNA localization	Any process in which oskar mRNA is transported to, or maintained in, the oocyte pole plasm.
	GO:0007318	pole plasm protein localization	Any process in which a protein is transported to, or maintained in, the oocyte pole plasm. An example of this is found in Drosophila melanogaster.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0046579	positive regulation of Ras protein signal transduction	Any process that activates or increases the frequency, rate or extent of Ras protein signal transduction.
	GO:0008104	protein localization	Any process in which a protein is transported to, or maintained in, a specific location.
	GO:0007317	regulation of pole plasm oskar mRNA localization	Any process that modulates the frequency, rate or extent of the process in which oskar mRNA is transported to, or maintained in, the oocyte pole plasm.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0071013	catalytic step 2 spliceosome	A spliceosomal complex that contains three snRNPs, including U5, bound to a splicing intermediate in which the first catalytic cleavage of the 5' splice site has occurred. The precise subunit composition differs significantly from that of the catalytic step 1, or activated, spliceosome, and includes many proteins in addition to those found in the associated snRNPs.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0035145	exon-exon junction complex	A multi-subunit complex deposited by the spliceosome upstream of messenger RNA exon-exon junctions. The exon-exon junction complex provides a binding platform for factors involved in mRNA export and nonsense-mediated mRNA decay.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0045495	pole plasm	Differentiated cytoplasm associated with a pole (animal, vegetal, anterior, or posterior) of an oocyte, egg or early embryo.
	GO:0071011	precatalytic spliceosome	A spliceosomal complex that is formed by the recruitment of a preassembled U5-containing tri-snRNP to the prespliceosome. Although all 5 snRNPs are present, the precatalytic spliceosome is catalytically inactive. The precatalytic spliceosome includes many proteins in addition to those found in the associated snRNPs.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (42, 60)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File