Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  RAL BINDING DOMAIN FROM SEC5
 
Authors :  H. R. Mott, D. Nietlispach, L. J. Hopkins, G. Mirey, J. H. Camonis, D. Owen
Date :  05 Mar 03  (Deposition) - 13 Mar 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (25x)
Keywords :  Ipt Ral Sec5 Exocyst, Exocytosis, Protein Transport, Immunoglobulin Fold (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. R. Mott, D. Nietlispach, L. J. Hopkins, G. Mirey, J. H. Camonis, D. Owen
Structure Of The Gtpase-Binding Domain Of Sec5 And Elucidation Of Its Ral Binding Site
J. Biol. Chem. V. 278 17053 2003
PubMed-ID: 12624092  |  Reference-DOI: 10.1074/JBC.M300155200

(-) Compounds

Molecule 1 - EXOCYST COMPLEX COMPONENT SEC5
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System VariantDE3
    Expression System VectorPET16B
    FragmentIPT DOMAIN, RESIDUES 5-97
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    Other DetailsHIS-MET AT N-TERMINUS FROM CLONING
    SynonymSEC5L1

 Structural Features

(-) Chains, Units

  
NMR Structure (25x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1HK6)

(-) Sites  (0, 0)

(no "Site" information available for 1HK6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1HK6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1HK6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1HK6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1HK6)

(-) Exons   (2, 2)

NMR Structure (2, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSMUST000000217851ENSMUSE00000430965chr13:31065916-3106586552EXOC2_MOUSE-00--
1.4ENSMUST000000217854ENSMUSE00000283541chr13:31032639-31032479161EXOC2_MOUSE1-40401A:3-4038
1.5ENSMUST000000217855ENSMUSE00000117289chr13:31030161-31029985177EXOC2_MOUSE40-99601A:40-9758
1.6ENSMUST000000217856ENSMUSE00000117295chr13:31027490-31027364127EXOC2_MOUSE99-141430--
1.7ENSMUST000000217857ENSMUSE00000117290chr13:31019290-31019177114EXOC2_MOUSE141-179390--
1.8ENSMUST000000217858ENSMUSE00000117305chr13:31017716-31017592125EXOC2_MOUSE179-221430--
1.9ENSMUST000000217859ENSMUSE00000117294chr13:31003119-3100303981EXOC2_MOUSE221-248280--
1.10ENSMUST0000002178510ENSMUSE00000117298chr13:30998746-30998601146EXOC2_MOUSE248-296490--
1.11ENSMUST0000002178511ENSMUSE00000117303chr13:30998453-3099837282EXOC2_MOUSE297-324280--
1.12ENSMUST0000002178512ENSMUSE00000117291chr13:30997624-30997522103EXOC2_MOUSE324-358350--
1.13ENSMUST0000002178513ENSMUSE00000660839chr13:30992772-30992654119EXOC2_MOUSE358-398410--
1.14ENSMUST0000002178514ENSMUSE00000660838chr13:30978183-30978058126EXOC2_MOUSE398-440430--
1.15ENSMUST0000002178515ENSMUSE00000362665chr13:30974242-30974118125EXOC2_MOUSE440-481420--
1.16ENSMUST0000002178516ENSMUSE00000394695chr13:30969482-3096941766EXOC2_MOUSE482-503220--
1.17ENSMUST0000002178517ENSMUSE00000660837chr13:30969269-30969112158EXOC2_MOUSE504-556530--
1.18ENSMUST0000002178518ENSMUSE00000117292chr13:30968721-30968600122EXOC2_MOUSE556-597420--
1.19ENSMUST0000002178519ENSMUSE00000343596chr13:30967189-3096712862EXOC2_MOUSE597-617210--
1.20ENSMUST0000002178520ENSMUSE00000117293chr13:30964238-3096415881EXOC2_MOUSE618-644270--
1.21ENSMUST0000002178521ENSMUSE00000117297chr13:30963770-3096371160EXOC2_MOUSE645-664200--
1.22ENSMUST0000002178522ENSMUSE00000117287chr13:30963049-3096298862EXOC2_MOUSE665-685210--
1.23ENSMUST0000002178523ENSMUSE00000283384chr13:30959907-3095984167EXOC2_MOUSE685-707230--
1.24ENSMUST0000002178524ENSMUSE00000283373chr13:30956816-30956700117EXOC2_MOUSE708-746390--
1.25ENSMUST0000002178525ENSMUSE00000283364chr13:30948664-30948523142EXOC2_MOUSE747-794480--
1.26ENSMUST0000002178526ENSMUSE00000283356chr13:30917963-3091790856EXOC2_MOUSE794-812190--
1.27ENSMUST0000002178527ENSMUSE00000283349chr13:30914623-30914501123EXOC2_MOUSE813-853410--
1.28ENSMUST0000002178528ENSMUSE00000283341chr13:30912508-3091244762EXOC2_MOUSE854-874210--
1.29ENSMUST0000002178529ENSMUSE00000283334chr13:30909926-3090986760EXOC2_MOUSE874-894210--
1.30ENSMUST0000002178530ENSMUSE00000660836chr13:30907260-309057881473EXOC2_MOUSE894-924310--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:95
 aligned with EXOC2_MOUSE | Q9D4H1 from UniProtKB/Swiss-Prot  Length:924

    Alignment length:95
                                    12        22        32        42        52        62        72        82        92     
           EXOC2_MOUSE    3 RSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK 97
               SCOP domains d1hk6a_ A: Exocyst complex component Sec5, Ral-binding domain                                   SCOP domains
               CATH domains 1hk6A00 A:3-97 Immunoglobulins                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee.........eeeeeee...........eee..ee.....ee.....eeee..........eee........ee........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: A:3-40 UniProt: 1-40   --------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.5  PDB: A:40-97 UniProt: 40-99 [INCOMPLETE]         Transcript 1 (2)
                  1hk6 A  3 HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK 97
                                    12        22        32        42        52        62        72        82        92     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1HK6)

(-) Gene Ontology  (15, 15)

NMR Structure(hide GO term definitions)
Chain A   (EXOC2_MOUSE | Q9D4H1)
molecular function
    GO:0017160    Ral GTPase binding    Interacting selectively and non-covalently with Ral protein, any member of the Ral subfamily of the Ras superfamily of monomeric GTPases.
    GO:0047485    protein N-terminus binding    Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
    GO:0006893    Golgi to plasma membrane transport    The directed movement of substances from the Golgi to the plasma membrane in transport vesicles that move from the trans-Golgi network to the plasma membrane, where they fuse and release their contents by exocytosis.
    GO:0001927    exocyst assembly    The aggregation, arrangement and bonding together of various polypeptides into the exocyst complex.
    GO:0006887    exocytosis    A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
    GO:0061024    membrane organization    A process which results in the assembly, arrangement of constituent parts, or disassembly of a membrane. A membrane is a double layer of lipid molecules that encloses all cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins.
    GO:0045921    positive regulation of exocytosis    Any process that activates or increases the frequency, rate or extent of exocytosis.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:2000535    regulation of entry of bacterium into host cell    Any process that modulates the frequency, rate or extent of entry of bacterium into host cell.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0000145    exocyst    A protein complex peripherally associated with the plasma membrane that determines where vesicles dock and fuse. At least eight complex components are conserved between yeast and mammals.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1hk6)
 
  Sites
(no "Sites" information available for 1hk6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1hk6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1hk6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EXOC2_MOUSE | Q9D4H1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  EXOC2_MOUSE | Q9D4H1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1HK6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1HK6)