![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1H9E) |
(no "Site" information available for 1H9E) |
(no "SS Bond" information available for 1H9E) |
(no "Cis Peptide Bond" information available for 1H9E) |
(no "SAP(SNP)/Variant" information available for 1H9E) |
NMR Structure (1, 1)
|
(no "Exon" information available for 1H9E) |
NMR StructureChain A from PDB Type:PROTEIN Length:56 aligned with LAP2A_HUMAN | P42166 from UniProtKB/Swiss-Prot Length:694 Alignment length:56 11 21 31 41 51 LAP2A_HUMAN 2 PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGT 57 SCOP domains d1h9ea_ A: Thymopoietin, LAP2 SCOP domains CATH domains 1h9eA00 A:1-56 [code=1.10.720.40, no name defined] CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE (2) ---LEM_LIKE PDB: A:4-47 UniProt: 5-48 --------- PROSITE (2) Transcript -------------------------------------------------------- Transcript 1h9e A 1 PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGT 56 10 20 30 40 50 Chain A from PDB Type:PROTEIN Length:56 aligned with LAP2B_HUMAN | P42167 from UniProtKB/Swiss-Prot Length:454 Alignment length:56 11 21 31 41 51 LAP2B_HUMAN 2 PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGT 57 SCOP domains d1h9ea_ A: Thymopoietin, LAP2 SCOP domains CATH domains 1h9eA00 A:1-56 [code=1.10.720.40, no name defined] CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE ---LEM_LIKE PDB: A:4-47 UniProt: 5-48 --------- PROSITE Transcript -------------------------------------------------------- Transcript 1h9e A 1 PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGT 56 10 20 30 40 50
|
NMR Structure
|
NMR Structure |
(no "Pfam Domain" information available for 1H9E) |
NMR Structure(hide GO term definitions) Chain A (LAP2B_HUMAN | P42167)
Chain A (LAP2A_HUMAN | P42166)
|
|
|
|
|
|
|