|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1H8K) |
Sites (0, 0)| (no "Site" information available for 1H8K) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1H8K) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1H8K) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1H8K) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1H8K) |
Exons (0, 0)| (no "Exon" information available for 1H8K) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:57 aligned with SPTN1_CHICK | P07751 from UniProtKB/Swiss-Prot Length:2477 Alignment length:57 978 988 998 1008 1018 SPTN1_CHICK 969 KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025 SCOP domains d1h8ka_ A: alpha-Spectrin, SH3 domain SCOP domains CATH domains 1h8kA00 A:6-62 SH3 Domains CATH domains Pfam domains --------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------- PROSITE Transcript --------------------------------------------------------- Transcript 1h8k A 6 KELVLVLYDYQEKSPREVTVKKGDILTLLNSTNKDWWKVEVDDRQGFIPAAYLKKLD 62 15 25 35 45 55
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1H8K) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (SPTN1_CHICK | P07751)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|