1H5R - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   THYMIDYLYLTRANSFERASE COMPLEXED WITH THIMIDINE AND GLUCOSE-1-PHOSPATE

Authors :   C. Rosano, S. Zuccotti, M. Bolognesi

Date :   25 May 01 (Deposition) - 23 Nov 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Transferase, Pyrophosphatase, Nucleotide Sugar Methabolism (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Zuccotti, D. Zanardi, C. Rosano, L. Sturla, M. Tonetti, M. Bolognesi
Kinetic And Crystallographic Analyses Support A Sequential-Ordered Bi Bi Catalytic Mechanism For Escherichia Coli Glucose-1-Phosphate Thymidylyltransferase
J. Mol. Biol. V. 313 831 2001
PubMed-ID: 11697907 | Reference-DOI: 10.1006/JMBI.2001.5073

Molecule 1 - GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
	Chains	:	A, C, D
	EC Number	:	2.7.7.24
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Synonym	:	TDP-GLUCOSE SYNTHASE, DTDP-GLUCOSE PYROPHOSPHORYLASE

Molecule 2 - GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
	Chains	:	B
	EC Number	:	2.7.7.24
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Synonym	:	TDP-GLUCOSE SYNTHASE, DTDP-GLUCOSE PYROPHOSPHORYLASE

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 17)

No.	Name	Count	Type	Full Name
1	G1P	4	Ligand/Ion	ALPHA-D-GLUCOSE-1-PHOSPHATE
2	SO4	5	Ligand/Ion	SULFATE ION
3	THM	8	Ligand/Ion	THYMIDINE

Asymmetric Unit (17, 17)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	LEU A:89 , TYR A:146 , GLY A:147 , GLU A:162 , LYS A:163 , VAL A:173 , TYR A:177 , THR A:201 , THM A:1293 , HOH A:2086 , HOH A:2087 , HOH A:2130 , HOH A:2131	BINDING SITE FOR RESIDUE G1P A1294
02	AC2	SOFTWARE	TYR B:146 , GLY B:147 , GLU B:162 , LYS B:163 , VAL B:173 , THR B:174 , GLY B:175 , ARG B:195 , THR B:201 , THM B:1293 , HOH B:2096	BINDING SITE FOR RESIDUE G1P B1294
03	AC3	SOFTWARE	LEU C:89 , LEU C:109 , TYR C:146 , GLY C:147 , GLU C:162 , LYS C:163 , VAL C:173 , ARG C:195 , THR C:201 , THM C:1293 , HOH C:2061 , HOH C:2072 , HOH C:2107	BINDING SITE FOR RESIDUE G1P C1294
04	AC4	SOFTWARE	LEU D:89 , LEU D:109 , ASN D:112 , TYR D:146 , GLY D:147 , GLU D:162 , LYS D:163 , VAL D:173 , TRP D:224 , THM D:1293 , HOH D:2078 , HOH D:2132	BINDING SITE FOR RESIDUE G1P D1294
05	AC5	SOFTWARE	HIS A:117 , ASP A:118 , THM A:1292 , GLY D:219 , ARG D:220 , GLY D:221 , HOH D:2099	BINDING SITE FOR RESIDUE SO4 A1295
06	AC6	SOFTWARE	ARG A:4 , VAL A:127 , HOH A:2132 , HOH A:2133 , HOH A:2134	BINDING SITE FOR RESIDUE SO4 A1296
07	AC7	SOFTWARE	HIS B:117 , ASP B:118 , THM B:1292 , HOH B:2097 , GLY C:219 , ARG C:220 , GLY C:221	BINDING SITE FOR RESIDUE SO4 B1295
08	AC8	SOFTWARE	GLY B:219 , GLY B:221 , HOH B:2073 , HIS C:117 , ASP C:118 , THM C:1292 , HOH C:2108	BINDING SITE FOR RESIDUE SO4 C1295
09	AC9	SOFTWARE	GLY A:219 , ARG A:220 , GLY A:221 , HOH A:2101 , HIS D:117 , ASP D:118 , THM D:1292 , HOH D:2134	BINDING SITE FOR RESIDUE SO4 D1295
10	BC1	SOFTWARE	LEU A:46 , TYR A:115 , GLY A:116 , VAL A:251 , SER A:252 , GLU A:256 , ILE A:257 , ARG A:260 , SO4 A:1295 , HOH A:2047 , HOH A:2128 , ARG D:220 , GLY D:221	BINDING SITE FOR RESIDUE THM A1292
11	BC2	SOFTWARE	LEU A:9 , GLY A:11 , GLY A:12 , GLN A:83 , PRO A:86 , ASP A:87 , GLY A:88 , LEU A:89 , ASP A:111 , GLU A:197 , G1P A:1294 , HOH A:2129	BINDING SITE FOR RESIDUE THM A1293
12	BC3	SOFTWARE	PHE B:114 , TYR B:115 , GLY B:116 , ASP B:118 , LEU B:119 , PRO B:120 , VAL B:251 , SER B:252 , SO4 B:1295 , HOH B:2016 , HOH B:2094	BINDING SITE FOR RESIDUE THM B1292
13	BC4	SOFTWARE	LEU B:9 , GLY B:11 , GLY B:12 , GLN B:83 , PRO B:86 , ASP B:87 , GLY B:88 , LEU B:89 , ASP B:111 , GLU B:197 , G1P B:1294 , HOH B:2095	BINDING SITE FOR RESIDUE THM B1293
14	BC5	SOFTWARE	LEU C:46 , TYR C:115 , GLY C:116 , ASP C:118 , LEU C:119 , PRO C:120 , SER C:252 , ILE C:257 , SO4 C:1295	BINDING SITE FOR RESIDUE THM C1292
15	BC6	SOFTWARE	LEU C:9 , ALA C:10 , GLY C:11 , GLY C:12 , GLN C:27 , GLN C:83 , PRO C:86 , ASP C:87 , GLY C:88 , LEU C:89 , LEU C:109 , ASP C:111 , GLU C:197 , G1P C:1294	BINDING SITE FOR RESIDUE THM C1293
16	BC7	SOFTWARE	TYR D:115 , GLY D:116 , ASP D:118 , LEU D:119 , PRO D:120 , VAL D:251 , SER D:252 , GLU D:256 , ILE D:257 , SO4 D:1295 , HOH D:2131	BINDING SITE FOR RESIDUE THM D1292
17	BC8	SOFTWARE	LEU D:9 , GLY D:11 , GLY D:12 , GLN D:27 , GLN D:83 , PRO D:86 , ASP D:87 , GLY D:88 , LEU D:89 , GLY D:110 , ASP D:111 , G1P D:1294	BINDING SITE FOR RESIDUE THM D1293

(no "SS Bond" information available for 1H5R)

Asymmetric/Biological Unit

No.	Residues
1	Tyr A:18	-	Pro A:19
2	Tyr B:18	-	Pro B:19
3	Tyr C:18	-	Pro C:19
4	Tyr D:18	-	Pro D:19
5	Lys D:290	-	Asp D:291

(no "SAP(SNP)/Variant" information available for 1H5R)

(no "PROSITE Motif" information available for 1H5R)

(no "Exon" information available for 1H5R)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:290
 aligned with RMLA1_ECOLI | P37744 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:290
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291
          RMLA1_ECOLI     2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD 291
               SCOP domains d1h5ra_ A: RmlA (RfbA)                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1h5rA00 A:2-291 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A                                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....hhhhh......hhhh.ee..ee.hhhhhhhhhhh.eeeeeeee...hhhhhhhhhh.hhhhh.eeeeee.......hhhhhhhhhhhh...eeeee...eee..hhhhhhhhhhhh...eeeeeee..hhhh.eeeee.....eeeeee........eeeeeeeee..hhhhhhhhh........hhhhhhhhhhhh..eeeee.....eee...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1h5r A   2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD 291
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291

Chain B from PDB  Type:PROTEIN  Length:290
 aligned with RMLA1_ECOLI | P37744 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:290
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291
          RMLA1_ECOLI     2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD 291
               SCOP domains d1h5rb_ B: RmlA (RfbA)                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1h5rB00 B:2-291 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A                                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....hhhhhhhhhhhhhhh.ee..ee.hhhhhhhhhhh...eeeeee...hhhhhhhhhh.hhhhh.eeeeee.......hhhhhhhhhhhh..eeeeee...eee..hhhhhhhhhhhh...eeeeeee..hhhh.eeeee.....eeeeee........eee..eeee..hhhhhhhh.........hhhhhhhhhhhh..eeeee.....eee...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1h5r B   2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVALMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKQTKD 291
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291

Chain C from PDB  Type:PROTEIN  Length:290
 aligned with RMLA1_ECOLI | P37744 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:290
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291
          RMLA1_ECOLI     2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD 291
               SCOP domains d1h5rc_ C: RmlA (RfbA)                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1h5rC00 C:2-291 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A                                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee....hhhhhhhhhhhhhhh.ee..ee.hhhhhhhhhhh...eeeeee...hhhhhhhhhh.hhhhh.eeeeee.......hhhhhhhhhhhh...eeeee...eee..hhhhhhhhhhhh...eeeeeee..hhhh.eeeee.....eeeeee........eeeeeeeee..hhhhhhhhh........hhhhhhhhhhhh..eeeee.....eee...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1h5r C   2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD 291
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291

Chain D from PDB  Type:PROTEIN  Length:290
 aligned with RMLA1_ECOLI | P37744 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:290
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291
          RMLA1_ECOLI     2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD 291
               SCOP domains d1h5rd_ D: RmlA (RfbA)                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1h5rD00 D:2-291 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A                                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee...............hhhh.ee..ee.hhhhhhhhhhh...eeeeee...hhhhhhhhhh.hhhhh.eeeeee.......hhhhhhhhhhhh...eeeee...eee..hhhhhhhhhhhh...eeeeeee..hhhh.eeeee.....eeeeee........eeeeeeeee..hhhhhhhhh........hhhhhhhhhhhh..eeeee.....eee...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1h5r D   2 KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKD 291
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Nucleotide-diphospho-sugar transferases (408)

Superfamily: Nucleotide-diphospho-sugar transferases (408)

Family: glucose-1-phosphate thymidylyltransferase (43)

Protein domain: RmlA (RfbA) (27)

Escherichia coli [TaxId: 562] (3)

1a	d1h5ra_	A:
1b	d1h5rb_	B:
1c	d1h5rc_	C:
1d	d1h5rd_	D:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A (231)

Homologous Superfamily: Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A (231)

Escherichia coli. Organism_taxid: 562. (5)

1a	1h5rA00	A:2-291
1b	1h5rC00	C:2-291
1c	1h5rD00	D:2-291
1d	1h5rB00	B:2-291

(no "Pfam Domain" information available for 1H5R)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (RMLA1_ECOLI | P37744)

molecular function
	GO:0008879	glucose-1-phosphate thymidylyltransferase activity	Catalysis of the reaction: alpha-D-glucose 1-phosphate + dTTP = diphosphate + dTDP-glucose.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0009243	O antigen biosynthetic process	The chemical reactions and pathways resulting in the formation of the O side chain of a lipopolysaccharide, which determines the antigenic specificity of the organism. It is made up of about 50 repeating units of a branched tetrasaccharide.
	GO:0009058	biosynthetic process	The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
	GO:0019305	dTDP-rhamnose biosynthetic process	The chemical reactions and pathways resulting in the formation of dTDP-rhamnose, a substance composed of rhamnose in glycosidic linkage with deoxyribosylthymine diphosphate.
	GO:0045226	extracellular polysaccharide biosynthetic process	The chemical reactions and pathways resulting in the formation of polysaccharides used in extracellular structures.
	GO:0009103	lipopolysaccharide biosynthetic process	The chemical reactions and pathways resulting in the formation of lipopolysaccharides, any of a group of related, structurally complex components of the outer membrane of Gram-negative bacteria.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		G1P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		THM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Lys D:290 - Asp D:291	[ RasMol ]
		Tyr A:18 - Pro A:19	[ RasMol ]
		Tyr B:18 - Pro B:19	[ RasMol ]
		Tyr C:18 - Pro C:19	[ RasMol ]
		Tyr D:18 - Pro D:19	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1h5r
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RMLA1_ECOLI \| P37744
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.7.24
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RMLA1_ECOLI \| P37744
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RMLA1_ECOLI \| P37744	:	1h5s 1h5t

1h5s	THE STRUCTURAL BASIS OF THE CATALYTIC MECHANISM ANDREGULATION OF GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE(RMLA). TMP COMPLEX.
1h5t	THYMIDYLYLTRANSFERASE COMPLEXED WITH THYMIDYLYLDIPHOSPHATE-GLUCOSE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 17)

Sites (17, 17)

SS Bonds (0, 0)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File