Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF CROTAMINE, A NEUROTOXIN FROM CROTALUS DURISSUS TERRIFICUS
 
Authors :  G. Nicastro, L. Franzoni, C. De Chiara, C. A. Mancin, J. R. Giglio, A. Spisni
Date :  23 May 01  (Deposition) - 09 May 03  (Release) - 24 Jul 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (26x)
NMR Structure *:  A  (1x)
Keywords :  Toxin, Sodium Channel Affecting Toxin, Venom (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Nicastro, L. Franzoni, C. De Chiara, A. C. A. Mancin, J. R. Giglio, A. Spisni
Solution Structure Of Crotamine, A Na+ Channel Affecting Toxin From Crotalus Durissus Terrificus Venom
Eur. J. Biochem. V. 270 1969 2003
PubMed-ID: 12709056  |  Reference-DOI: 10.1046/J.1432-1033.2003.03563.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MYOTOXIN
    Chains: A
    Organism Common: SOUTH AMERICAN RATTLESNAKE
    Organism Scientific: CROTALUS DURISSUS TERRIFICUS
    Organism Taxid: 8732
    Other Details: VENOM OF THE RATTLESNAKE CROTALUS DURISSUS TERRIFICUS
    Synonym: CROTAMINE

 Structural Features

(-) Chains, Units

  1
NMR Structure (26x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1H5O)

(-) Sites  (0, 0)

(no "Site" information available for 1H5O)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:4 -A:36
2A:11 -A:30
3A:18 -A:37

(-) Cis Peptide Bonds  (1, 26)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26Leu A:19 -Pro A:20

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1H5O)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MYOTOXINS_2PS51345 Myotoxins family profile.MYC2_CRODU23-64  1A:1-42
2MYOTOXINS_1PS00459 Myotoxins signature.MYC2_CRODU24-61  1A:2-39
NMR Structure * (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MYOTOXINS_2PS51345 Myotoxins family profile.MYC2_CRODU23-64  1A:1-42
2MYOTOXINS_1PS00459 Myotoxins signature.MYC2_CRODU24-61  1A:2-39

(-) Exons   (0, 0)

(no "Exon" information available for 1H5O)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:42
 aligned with MYC2_CRODU | Q9PWF3 from UniProtKB/Swiss-Prot  Length:65

    Alignment length:42
                                    32        42        52        62  
            MYC2_CRODU   23 YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG 64
               SCOP domains d1h5oa_ A: Crotamine                       SCOP domains
               CATH domains 1h5oA00 A:1-42 Anthopleurin-A              CATH domains
               Pfam domains ------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhh.eeee...........ee.........eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------ SAPs(SNPs)
                PROSITE (1) MYOTOXINS_2  PDB: A:1-42 UniProt: 23-64    PROSITE (1)
                PROSITE (2) -MYOTOXINS_1  PDB: A:2-39              --- PROSITE (2)
                 Transcript ------------------------------------------ Transcript
                  1h5o A  1 YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG 42
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1H5O)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (MYC2_CRODU | Q9PWF3)
biological process
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0044564    envenomation resulting in occlusion of the pore of voltage-gated potassium channel in other organism    A process that begins with venom being forced into an organism by the bite or sting of another organism, and ends with a resultant blocking of a voltage-gated potassium channel, inhibiting the pore's activity, in the bitten/stung organism.
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1h5o)
 
  Sites
(no "Sites" information available for 1h5o)
 
  Cis Peptide Bonds
    Leu A:19 - Pro A:20   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1h5o
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MYC2_CRODU | Q9PWF3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MYC2_CRODU | Q9PWF3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MYC2_CRODU | Q9PWF3: 1z99 4gv5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1H5O)