|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1H4B) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1H4B) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1H4B) |
PROSITE Motifs (2, 4)
NMR Structure (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1H4B) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:84 aligned with POLC4_BETPN | Q39419 from UniProtKB/Swiss-Prot Length:85 Alignment length:84 11 21 31 41 51 61 71 81 POLC4_BETPN 2 ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF 85 SCOP domains d1h4ba_ A: Polcalcin bet v 4 SCOP domains CATH domains 1h4bA00 A:1-84 EF-hand CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE (1) -----EF_HAND_2 PDB: A:6-41 UniProt: 7-42--EF_HAND_2 PDB: A:44-76 -------- PROSITE (1) PROSITE (2) ------------------EF_HAND_1 ----------------------EF_HAND_1 ------------------ PROSITE (2) Transcript ------------------------------------------------------------------------------------ Transcript 1h4b A 1 ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF 84 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1H4B) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (POLC4_BETPN | Q39419)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|