1GTU - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   LIGAND-FREE HUMAN GLUTATHIONE S-TRANSFERASE M1A-1A

Authors :   Y. V. Patskovsky, L. N. Patskovska, I. Listowsky

Date :   11 Jun 98 (Deposition) - 02 Feb 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.68

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Transferase, Glutathione, Conjugation, Detoxification, Cytosolic, Dimer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. V. Patskovsky, L. N. Patskovska, I. Listowsky
Functions Of His107 In The Catalytic Mechanism Of Human Glutathione S-Transferase Hgstm1A-1A.
Biochemistry V. 38 1193 1999
PubMed-ID: 9930979 | Reference-DOI: 10.1021/BI982164M
(for further references see the PDB file header)

Molecule 1 - GLUTATHIONE S-TRANSFERASE
	Cellular Location	:	CYTOPLASM
	Cell Line	:	HELA
	Chains	:	A, B, C, D
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Gene	:	GSTM1A
	Expression System Plasmid	:	PET3A-GSTM1A
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Gene	:	GSTM1A
	Organ	:	LIVER
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	LIGAND-FREE
	Other Details - Source	:	THE GSTM1A CDNA WAS AMPLIFIED USING RT-PCR AND SUBCLONED INTO A PET3A EXPRESSION VECTOR

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1GTU)

(no "Site" information available for 1GTU)

(no "SS Bond" information available for 1GTU)

Asymmetric Unit

No.	Residues
1	Leu A:59	-	Pro A:60
2	Arg A:205	-	Pro A:206
3	Leu B:59	-	Pro B:60
4	Arg B:205	-	Pro B:206
5	Leu C:59	-	Pro C:60
6	Arg C:205	-	Pro C:206
7	Leu D:59	-	Pro D:60
8	Arg D:205	-	Pro D:206

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_003617	K	173	N	GSTM1_HUMAN	Polymorphism	1065411	A/B/C/D	K	172	N
2	UniProt	VAR_014497	S	210	T	GSTM1_HUMAN	Polymorphism	449856	A/B/C/D	S	209	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_003617	K	173	N	GSTM1_HUMAN	Polymorphism	1065411	A/B	K	172	N
2	UniProt	VAR_014497	S	210	T	GSTM1_HUMAN	Polymorphism	449856	A/B	S	209	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_003617	K	173	N	GSTM1_HUMAN	Polymorphism	1065411	C/D	K	172	N
2	UniProt	VAR_014497	S	210	T	GSTM1_HUMAN	Polymorphism	449856	C/D	S	209	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTM1_HUMAN	90-208	4	A:89-207 B:89-207 C:89-207 D:89-207

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTM1_HUMAN	90-208	2	A:89-207 B:89-207 - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTM1_HUMAN	90-208	2	- - C:89-207 D:89-207

Asymmetric Unit (8, 32)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1e	ENST00000309851	1e	ENSE00001850517	chr1:110230472-110230531	60	GSTM1_HUMAN	1-12	12	4	A:1-11 B:1-11 C:1-11 D:1-11	11 11 11 11
1.2a	ENST00000309851	2a	ENSE00001753103	chr1:110230792-110230867	76	GSTM1_HUMAN	13-38	26	4	A:12-37 B:12-37 C:12-37 D:12-37	26 26 26 26
1.2d	ENST00000309851	2d	ENSE00001706290	chr1:110231295-110231359	65	GSTM1_HUMAN	38-59	22	4	A:37-58 B:37-58 C:37-58 D:37-58	22 22 22 22
1.2h	ENST00000309851	2h	ENSE00001631442	chr1:110231670-110231751	82	GSTM1_HUMAN	60-87	28	4	A:59-86 B:59-86 C:59-86 D:59-86	28 28 28 28
1.3	ENST00000309851	3	ENSE00000826761	chr1:110231847-110231947	101	GSTM1_HUMAN	87-120	34	4	A:86-119 B:86-119 C:86-119 D:86-119	34 34 34 34
1.4b	ENST00000309851	4b	ENSE00001715778	chr1:110232893-110232988	96	GSTM1_HUMAN	121-152	32	4	A:120-151 B:120-151 C:120-151 D:120-151	32 32 32 32
1.5a	ENST00000309851	5a	ENSE00001716973	chr1:110233076-110233186	111	GSTM1_HUMAN	153-189	37	4	A:152-188 B:152-188 C:152-188 D:152-188	37 37 37 37
1.7d	ENST00000309851	7d	ENSE00001825142	chr1:110235828-110236367	540	GSTM1_HUMAN	190-218	29	4	A:189-217 B:189-217 C:189-217 D:189-217	29 29 29 29

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:217
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM1_HUMAN     2 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d1gtua2 A:1-84 Class mu GST                                                         d1gtua1 A:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 1gtuA01 A:1-85,A:191-217 Glutaredoxin                                                1gtuA02 A:86-190  [code=1.20.1050.10, no name defined]                                                   1gtuA01 A:1-85,A:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhh...........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh........hhhhhhhhhhh..hhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------GST_CTER  PDB: A:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e  Exon 1.2a  PDB: A:12-37   ---------------------Exon 1.2h  PDB: A:59-86     ---------------------------------Exon 1.4b  PDB: A:120-151       Exon 1.5a  PDB: A:152-188            Exon 1.7d  PDB: A:189-217     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2d  PDB: A:37-5---------------------------Exon 1.3  PDB: A:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1gtu A   1 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain B from PDB  Type:PROTEIN  Length:217
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM1_HUMAN     2 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d1gtub2 B:1-84 Class mu GST                                                         d1gtub1 B:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 1gtuB01 B:1-85,B:191-217 Glutaredoxin                                                1gtuB02 B:86-190  [code=1.20.1050.10, no name defined]                                                   1gtuB01 B:1-85,B:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhh...........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh...hhhh.hhhhhhhhhhhh.hhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------GST_CTER  PDB: B:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e  Exon 1.2a  PDB: B:12-37   ---------------------Exon 1.2h  PDB: B:59-86     ---------------------------------Exon 1.4b  PDB: B:120-151       Exon 1.5a  PDB: B:152-188            Exon 1.7d  PDB: B:189-217     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2d  PDB: B:37-5---------------------------Exon 1.3  PDB: B:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1gtu B   1 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain C from PDB  Type:PROTEIN  Length:217
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM1_HUMAN     2 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d1gtuc2 C:1-84 Class mu GST                                                         d1gtuc1 C:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 1gtuC01 C:1-85,C:191-217 Glutaredoxin                                                1gtuC02 C:86-190  [code=1.20.1050.10, no name defined]                                                   1gtuC01 C:1-85,C:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhh...........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh........hhhhhhhhhhhh.hhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------GST_CTER  PDB: C:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e  Exon 1.2a  PDB: C:12-37   ---------------------Exon 1.2h  PDB: C:59-86     ---------------------------------Exon 1.4b  PDB: C:120-151       Exon 1.5a  PDB: C:152-188            Exon 1.7d  PDB: C:189-217     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2d  PDB: C:37-5---------------------------Exon 1.3  PDB: C:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1gtu C   1 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain D from PDB  Type:PROTEIN  Length:217
 aligned with GSTM1_HUMAN | P09488 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM1_HUMAN     2 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 218
               SCOP domains d1gtud2 D:1-84 Class mu GST                                                         d1gtud1 D:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 1gtuD01 D:1-85,D:191-217 Glutaredoxin                                                1gtuD02 D:86-190  [code=1.20.1050.10, no name defined]                                                   1gtuD01 D:1-85,D:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhhhh.........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh...hhhh.hhhhhhhhhhh..hhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------N------------------------------------T-------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------GST_CTER  PDB: D:89-207 UniProt: 90-208                                                                                ---------- PROSITE
           Transcript 1 (1) Exon 1.1e  Exon 1.2a  PDB: D:12-37   ---------------------Exon 1.2h  PDB: D:59-86     ---------------------------------Exon 1.4b  PDB: D:120-151       Exon 1.5a  PDB: D:152-188            Exon 1.7d  PDB: D:189-217     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2d  PDB: D:37-5---------------------------Exon 1.3  PDB: D:86-119           -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1gtu D   1 PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: Glutathione S-transferase (GST), C-terminal domain (263)

Protein domain: Class mu GST (33)

Human (Homo sapiens) [TaxId: 9606] (15)

1a	d1gtua1	A:85-217
1b	d1gtub1	B:85-217
1c	d1gtuc1	C:85-217
1d	d1gtud1	D:85-217

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: Glutathione S-transferase (GST), N-terminal domain (216)

Protein domain: Class mu GST (33)

Human (Homo sapiens) [TaxId: 9606] (15)

2a	d1gtua2	A:1-84
2b	d1gtub2	B:1-84
2c	d1gtuc2	C:1-84
2d	d1gtud2	D:1-84

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Human (Homo sapiens) (186)

1a	1gtuA01	A:1-85,A:191-217
1b	1gtuB01	B:1-85,B:191-217
1c	1gtuC01	C:1-85,C:191-217
1d	1gtuD01	D:1-85,D:191-217

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 (267)

Homologous Superfamily: [code=1.20.1050.10, no name defined] (249)

Human (Homo sapiens) (119)

2a	1gtuA02	A:86-190
2b	1gtuB02	B:86-190
2c	1gtuC02	C:86-190
2d	1gtuD02	D:86-190

(no "Pfam Domain" information available for 1GTU)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (GSTM1_HUMAN | P09488)

molecular function
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0043295	glutathione binding	Interacting selectively and non-covalently with glutathione; a tripeptide composed of the three amino acids cysteine, glutamic acid and glycine.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0070458	cellular detoxification of nitrogen compound	Any cellular process that reduces or removes the toxicity of nitrogenous compounds which are dangerous or toxic. This includes the aerobic conversion of toxic compounds to harmless substances.
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0018916	nitrobenzene metabolic process	The chemical reactions and pathways involving nitrobenzene (nitrobenzol), a derivative of benzene with an NO2 group attached to the ring. It is a yellow aromatic liquid used in perfumery and manufactured in large quantities in the preparation of aniline.
	GO:0042178	xenobiotic catabolic process	The chemical reactions and pathways resulting in the breakdown of a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1gtu)

	Sites
(no "Sites" information available for 1gtu)

	Cis Peptide Bonds
		Arg A:205 - Pro A:206	[ RasMol ]
		Arg B:205 - Pro B:206	[ RasMol ]
		Arg C:205 - Pro C:206	[ RasMol ]
		Arg D:205 - Pro D:206	[ RasMol ]
		Leu A:59 - Pro A:60	[ RasMol ]
		Leu B:59 - Pro B:60	[ RasMol ]
		Leu C:59 - Pro C:60	[ RasMol ]
		Leu D:59 - Pro D:60	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1gtu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GSTM1_HUMAN \| P09488
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GSTM1_HUMAN \| P09488
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GSTM1_HUMAN \| P09488	:	1xw6 1xwk 1yj6 2f3m

(no "Related Entries Specified in the PDB File" available for 1GTU)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (1, 4)

Exons (8, 32)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File