|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1GH9) |
Sites (0, 0)| (no "Site" information available for 1GH9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1GH9) |
Cis Peptide Bonds (1, 2)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1GH9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1GH9) |
Exons (0, 0)| (no "Exon" information available for 1GH9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:71 aligned with PA84_METTH | O27252 from UniProtKB/Swiss-Prot Length:71 Alignment length:71 10 20 30 40 50 60 70 PA84_METTH 1 MYIIFRCDCGRALYSREGAKTRKCVCGRTVNVKDRRIFGRADDFEEASELVRKLQEEKYGSCHFTNPSKRE 71 SCOP domains d1gh9a_ A: Hypothetical protein MTH1184 SCOP domains CATH domains 1gh9A00 A:1-71 CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 1gh9 A 1 MYIIFRCDCGRALYSREGAKTRKCVCGRTVNVKDRRIFGRADDFEEASELVRKLQEEKYGSCHFTNPSKRE 71 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1GH9) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1GH9)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|