|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1GH8) |
Sites (0, 0)| (no "Site" information available for 1GH8) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1GH8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1GH8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1GH8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1GH8) |
Exons (0, 0)| (no "Exon" information available for 1GH8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:89 aligned with EF1B_METTH | O27734 from UniProtKB/Swiss-Prot Length:89 Alignment length:89 10 20 30 40 50 60 70 80 EF1B_METTH 1 MGDVVATIKVMPESPDVDLEALKKEIQERIPEGTELHKIDEEPIAFGLVALNVMVVVGDAEGGTEAAEESLSGIEGVSNIEVTDVRRLM 89 SCOP domains d1gh8a_ A: aEF-1beta SCOP domains CATH domains 1gh8A00 A:1-89 [code=3.30.70.60, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1gh8 A 1 MGDVVATIKVMPESPDVDLEALKKEIQERIPEGTELHKIDEEPIAFGLVALNVMVVVGDAEGGTEAAEESLSGIEGVSNIEVTDVRRLM 89 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1GH8) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (EF1B_METTH | O27734)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|