|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1GH5) |
Sites (0, 0)| (no "Site" information available for 1GH5) |
SS Bonds (1, 1)
NMR Structure
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1GH5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1GH5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1GH5) |
Exons (0, 0)| (no "Exon" information available for 1GH5) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:87 aligned with Q9RCK8_STRTE | Q9RCK8 from UniProtKB/TrEMBL Length:128 Alignment length:87 51 61 71 81 91 101 111 121 Q9RCK8_STRTE 42 TINRTDCNENSYLEIHNNEGRDTLCFANAGTMPVAIYGVNWVESGNNVVTLQFQRNLSDPRLETITLQKWGSWNPGHIHEILSIRIY 128 SCOP domains d1gh5a_ A: Antifungal protein AFP1 SCOP domains CATH domains 1gh5A00 A:1-87 [code=2.60.20.30, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 1gh5 A 1 MINRTDCNENSYLEIHNNEGRDTLCFANAGTMPVAIYGVNWVESGNNVVTLQFQRNLSDPRLETITLQKWGSWNPGHIHEILSIRIY 87 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1GH5) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1GH5)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|