Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CDC4P FROM SCHIZOSACCHAROMYCES POMBE
 
Authors :  C. M. Slupsky, S. M. Hemmingsen, L. P. Mcintosh
Date :  25 Sep 00  (Deposition) - 21 Mar 01  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (26x)
Keywords :  Light Chain, Cytokinesis, Cell Cycle, Ef-Hand (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. M. Slupsky, M. Desautels, T. Huebert, R. Zhao, S. M. Hemmingsen, L. P. Mcintosh
Structure Of Cdc4P, A Contractile Ring Protein Essential For Cytokinesis In Schizosaccharomyces Pombe.
J. Biol. Chem. V. 276 5943 2001
PubMed-ID: 11087750  |  Reference-DOI: 10.1074/JBC.M008716200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (CDC4P)
    Cellular LocationCYTOPLASM
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System Cellular LocationCYTOPLASM
    Expression System GeneCDC4
    Expression System PlasmidPT7-7
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonFISSION YEAST
    Organism ScientificSCHIZOSACCHAROMYCES POMBE
    Organism Taxid4896
    StrainWILD-TYPE 972
    SynonymEF-HAND PROTEIN, MYOSIN LIGHT CHAIN

 Structural Features

(-) Chains, Units

  
NMR Structure (26x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1GGW)

(-) Sites  (0, 0)

(no "Site" information available for 1GGW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1GGW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1GGW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1GGW)

(-) PROSITE Motifs  (2, 4)

NMR Structure (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.MLR4_SCHPO3-38
74-109
125-141
  3A:3-38
A:74-109
A:125-141
2EF_HAND_1PS00018 EF-hand calcium-binding domain.MLR4_SCHPO87-99  1A:87-99

(-) Exons   (0, 0)

(no "Exon" information available for 1GGW)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:140
 aligned with MLR4_SCHPO | Q09196 from UniProtKB/Swiss-Prot  Length:141

    Alignment length:140
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141
           MLR4_SCHPO     2 STDDSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTLPAEVDMEQFLQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDFVQMILAN 141
               SCOP domains d1ggwa_ A: Cdc4p                                                                                                                             SCOP domains
               CATH domains 1ggwA01 A:2-68 EF-hand                                             1ggwA02 A:69-138 EF-hand                                              --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhh.......eee.hhhhhhhhhh.....hhhhhhhhh....eee.hhhhhhh..............hhhhhhhh......eeehhhhhhhhhh.......hhhhhhh.......eee...hhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -EF_HAND_2  PDB: A:3-38 UniProt: 3-38-----------------------------------EF_HAND_2  PDB: A:74-109            ---------------EF_HAND_2         PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------EF_HAND_1    ------------------------------------------ PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ggw A   2 STDDSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTLPAEVDMEQFLQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDFVQMILAN 141
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1GGW)

(-) Gene Ontology  (17, 17)

NMR Structure(hide GO term definitions)
Chain A   (MLR4_SCHPO | Q09196)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0000917    barrier septum assembly    The assembly and arrangement of a septum that spans the plasma membrane interface between progeny cells following cytokinesis. The progeny cells that form a barrier septum are not able to exchange intracellular material.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:1903475    mitotic actomyosin contractile ring assembly    Any actomyosin contractile ring assembly that is involved in mitotic cytokinesis.
    GO:1903479    mitotic actomyosin contractile ring assembly actin filament organization    Any actin filament organization that is involved in mitotic actomyosin contractile ring assembly.
    GO:0071574    protein localization to medial cortex    A process in which a protein is transported to, or maintained in, the medial cortex.
cellular component
    GO:0005826    actomyosin contractile ring    A cytoskeletal structure composed of actin filaments and myosin that forms beneath the plasma membrane of many cells, including animal cells and yeast cells, in a plane perpendicular to the axis of the spindle, i.e. the cell division plane. Ring contraction is associated with centripetal growth of the membrane that divides the cytoplasm of the two daughter cells. In animal cells, the contractile ring is located inside the plasma membrane at the location of the cleavage furrow. In budding fungal cells, e.g. mitotic S. cerevisiae cells, the contractile ring forms beneath the plasma membrane at the mother-bud neck before mitosis.
    GO:0032153    cell division site    The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0071341    medial cortical node    A component of the cell division site that contains the mid1, cdr2, wee1, klp8, and blt1 proteins, and is involved in contractile ring localization. Medial cortical node complexes appear as cortical dots in the middle of the cell during interphase, and function to recruit other ring components in early mitosis.
    GO:0016460    myosin II complex    A myosin complex containing two class II myosin heavy chains, two myosin essential light chains and two myosin regulatory light chains. Also known as classical myosin or conventional myosin, the myosin II class includes the major muscle myosin of vertebrate and invertebrate muscle, and is characterized by alpha-helical coiled coil tails that self assemble to form a variety of filament structures.
    GO:0016459    myosin complex    A protein complex, formed of one or more myosin heavy chains plus associated light chains and other proteins, that functions as a molecular motor; uses the energy of ATP hydrolysis to move actin filaments or to move vesicles or other cargo on fixed actin filaments; has magnesium-ATPase activity and binds actin. Myosin classes are distinguished based on sequence features of the motor, or head, domain, but also have distinct tail regions that are believed to bind specific cargoes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ggw)
 
  Sites
(no "Sites" information available for 1ggw)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ggw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ggw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MLR4_SCHPO | Q09196
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MLR4_SCHPO | Q09196
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1GGW)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1GGW)