|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1GD6) |
Sites (0, 0)| (no "Site" information available for 1GD6) |
SS Bonds (4, 4)
Asymmetric/Biological Unit
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1GD6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1GD6) |
PROSITE Motifs (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1GD6) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:119 aligned with LYS_BOMMO | P48816 from UniProtKB/Swiss-Prot Length:137 Alignment length:119 28 38 48 58 68 78 88 98 108 118 128 LYS_BOMMO 19 KTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHRFDAWYGWKNHCQGSLPDISSC 137 SCOP domains d1gd6a_ A: Lysozyme SCOP domains CATH domains 1gd6A00 A:1-119 [code=1.10.530.10, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) LACTALBUMIN_LYSOZYME_2 PDB: A:1-119 UniProt: 19-137 PROSITE (1) PROSITE (2) ----------------------------------------------------------------------LACTALBUMIN_LYSOZYM------------------------------ PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 1gd6 A 1 KTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHRFDAWYGWKNHCQGSLPDISSC 119 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1GD6) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (LYS_BOMMO | P48816)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|