1GAM - JenaLib

Title :   GAMMA B CRYSTALLIN TRUNCATED C-TERMINAL DOMAIN

Authors :   B. V. Norledge, E. -M. Mayr, R. Glockshuber, O. A. Bateman, C. Slingsby, R. Jaenicke, H. P. C. Driessen

Date :   02 Feb 96 (Deposition) - 11 Jul 96 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym./Biol. Unit : A,B

Keywords :   Gamma Crystallin B, Eye Lens Protein, Multigene Family, Eye- Lens Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. V. Norledge, E. M. Mayr, R. Glockshuber, O. A. Bateman, C. Slingsby, R. Jaenicke, H. P. Driessen
The X-Ray Structures Of Two Mutant Crystallin Domains Shed Light On The Evolution Of Multi-Domain Proteins.
Nat. Struct. Biol. V. 3 267 1996
PubMed-ID: 8605629 | Reference-DOI: 10.1038/NSB0396-267
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (1, 2)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:86
 aligned with CRGB_BOVIN | P02526 from UniProtKB/Swiss-Prot  Length:175

    Alignment length:86
                                    97       107       117       127       137       147       157       167      
           CRGB_BOVIN    88 TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMD 173
               SCOP domains d1gama_ A: gamma-Crystallin                                                            SCOP domains
               CATH domains 1gamA00 A:87-172 Crystallins                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee........eeee......hhhhh......eeeeee..eeee........eeee..eee..hhhh........eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -CRYSTALLIN_BETA_GAMMA  PDB: A:88-128     CRYSTALLIN_BETA_GAMMA  PDB: A:129-171      - PROSITE
               Transcript 1 Exon 1.3  PDB: A:87-172 UniProt: 85-175 [INCOMPLETE]                                   Transcript 1
                 1gam A  87 TFRMRIYERDDFRGQMSEITADCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMD 172
                                    96       106       116       126       136       146       156       166

Chain B from PDB  Type:PROTEIN  Length:86
 aligned with CRGB_BOVIN | P02526 from UniProtKB/Swiss-Prot  Length:175

    Alignment length:86
                                    97       107       117       127       137       147       157       167      
           CRGB_BOVIN    88 TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMD 173
               SCOP domains d1gamb_ B: gamma-Crystallin                                                            SCOP domains
               CATH domains 1gamB00 B:87-172 Crystallins                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhh...eeee......hhhhh......eeeeee..eeee........eeee..eee..hhhh........eeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -CRYSTALLIN_BETA_GAMMA  PDB: B:88-128     CRYSTALLIN_BETA_GAMMA  PDB: B:129-171      - PROSITE
               Transcript 1 Exon 1.3  PDB: B:87-172 UniProt: 85-175 [INCOMPLETE]                                   Transcript 1
                 1gam B  87 TFRMRIYERDDFRGQMSEITADCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMD 172
                                    96       106       116       126       136       146       156       166

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (CRGB_BOVIN | P02526)

molecular function
	GO:0005212	structural constituent of eye lens	The action of a molecule that contributes to the structural integrity of the lens of an eye.
biological process
	GO:0001654	eye development	The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
	GO:0002088	lens development in camera-type eye	The process whose specific outcome is the progression of the lens over time, from its formation to the mature structure. The lens is a transparent structure in the eye through which light is focused onto the retina. An example of this process is found in Mus musculus.
	GO:0070307	lens fiber cell development	The process whose specific outcome is the progression of a lens fiber cell over time, from its formation to the mature structure. Cell development does not include the steps involved in committing a cell to a lens fiber cell fate. A lens fiber cell is any of the elongated, tightly packed cells that make up the bulk of the mature lens in a camera-type eye.
	GO:0070309	lens fiber cell morphogenesis	The process in which the structures of a lens fiber cell are generated and organized. This process occurs while the initially relatively unspecialized cell is acquiring the specialized features of a lens fiber cell. A lens fiber cell is any of the elongated, tightly packed cells that make up the bulk of the mature lens in a camera-type eye.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1gam)

	Sites
(no "Sites" information available for 1gam)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1gam)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)
Prepi
	ribbon, secondary structure, chain-specific coloring, helix N-terminus colored in brass [ mono GIF format \| stereo GIF format ]
	ribbon, secondary structure, chain-specific coloring, helix N-terminus colored in brass, white background [ mono GIF format \| stereo GIF format ]
	C alpha wire, chain-specific coloring, sequence [ mono GIF format \| stereo GIF format ]
	spacefill, chain-specific coloring [ mono GIF format \| stereo GIF format ]

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1gam
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CRGB_BOVIN \| P02526
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description