Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THIAMIN PHOSPHATE SYNTHASE
 
Authors :  D. H. Peapus, H. -J. Chiu, N. Campobasso, J. J. Reddick, T. P. Begley, S. E. Ealick
Date :  03 Nov 00  (Deposition) - 26 Sep 01  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Thiamin Biosynthesis, Tim Barrel, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. H. Peapus, H. J. Chiu, N. Campobasso, J. J. Reddick, T. P. Begley, S. E. Ealick
Structural Characterization Of The Enzyme-Substrate, Enzyme-Intermediate, And Enzyme-Product Complexes Of Thiamin Phosphate Synthase.
Biochemistry V. 40 10103 2001
PubMed-ID: 11513589  |  Reference-DOI: 10.1021/BI0104726
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THIAMIN PHOSPHATE SYNTHASE
    ChainsA, B
    EC Number2.5.1.3
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPYZC6927
    Expression System StrainSG13009 WITH PREP4
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneTHIC
    MutationYES
    Organism ScientificBACILLUS SUBTILIS
    Organism Taxid1423
    Other DetailsCOMPLEXED WITH 2-METHYL-5-METHYLENE-5H- PYRIMIDIN-4-YLIDENEAMINE, 4-METHYL-5-HYDROXYETHYLTHIAZOLE PHOSPHATE AND PYROPHOSPHATE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric Unit (4, 8)
No.NameCountTypeFull Name
1ICP2Ligand/Ion2-METHYL-5-METHYLENE-5H-PYRIMIDIN-4-YLIDENEAMINE
2MG2Ligand/IonMAGNESIUM ION
3POP2Ligand/IonPYROPHOSPHATE 2-
4TZP2Ligand/Ion4-METHYL-5-HYDROXYETHYLTHIAZOLE PHOSPHATE
Biological Unit 1 (3, 3)
No.NameCountTypeFull Name
1ICP1Ligand/Ion2-METHYL-5-METHYLENE-5H-PYRIMIDIN-4-YLIDENEAMINE
2MG-1Ligand/IonMAGNESIUM ION
3POP1Ligand/IonPYROPHOSPHATE 2-
4TZP1Ligand/Ion4-METHYL-5-HYDROXYETHYLTHIAZOLE PHOSPHATE
Biological Unit 2 (3, 3)
No.NameCountTypeFull Name
1ICP1Ligand/Ion2-METHYL-5-METHYLENE-5H-PYRIMIDIN-4-YLIDENEAMINE
2MG-1Ligand/IonMAGNESIUM ION
3POP1Ligand/IonPYROPHOSPHATE 2-
4TZP1Ligand/Ion4-METHYL-5-HYDROXYETHYLTHIAZOLE PHOSPHATE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:61 , ASP A:93 , ASP A:112 , POP A:2003 , HOH A:2101 , HOH A:2102BINDING SITE FOR RESIDUE MG A 2007
2AC2SOFTWARELYS B:1061 , ASP B:1093 , ASP B:1112 , POP B:2004 , HOH B:2201 , HOH B:2202BINDING SITE FOR RESIDUE MG B 2008
3AC3SOFTWARETYR A:29 , ILE A:31 , GLN A:57 , HIS A:107 , GLY A:149 , VAL A:184 , ILE A:186 , POP A:2003 , TZP A:2005BINDING SITE FOR RESIDUE ICP A 2001
4AC4SOFTWAREARG A:59 , LYS A:61 , ASN A:92 , HIS A:107 , GLY A:109 , ASP A:112 , ALA A:130 , LYS A:159 , ICP A:2001 , TZP A:2005 , MG A:2007 , HOH A:2101 , HOH A:2102 , HOH A:2105BINDING SITE FOR RESIDUE POP A 2003
5AC5SOFTWAREARG A:59 , THR A:156 , THR A:158 , LYS A:159 , ILE A:186 , GLY A:188 , MET A:207 , ILE A:208 , SER A:209 , ICP A:2001 , POP A:2003 , HOH A:2301 , HOH A:2302 , HOH A:2305BINDING SITE FOR RESIDUE TZP A 2005
6AC6SOFTWARETYR B:1029 , ILE B:1031 , GLN B:1057 , HIS B:1107 , GLY B:1149 , POP B:2004 , TZP B:2006BINDING SITE FOR RESIDUE ICP B 2002
7AC7SOFTWAREARG B:1059 , LYS B:1061 , ASN B:1092 , ASP B:1093 , GLY B:1109 , GLU B:1111 , ALA B:1130 , LYS B:1159 , ICP B:2002 , MG B:2008 , HOH B:2201 , HOH B:2202 , HOH B:2205 , HOH B:2207BINDING SITE FOR RESIDUE POP B 2004
8AC8SOFTWAREARG B:1059 , THR B:1156 , THR B:1158 , LYS B:1159 , ILE B:1186 , GLY B:1188 , MET B:1207 , ILE B:1208 , SER B:1209 , ICP B:2002 , HOH B:2401 , HOH B:2402 , HOH B:2405BINDING SITE FOR RESIDUE TZP B 2006

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1G69)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:151 -Pro A:152
2Gly B:1151 -Pro B:1152

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1G69)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1G69)

(-) Exons   (0, 0)

(no "Exon" information available for 1G69)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:226
 aligned with THIE_BACSU | P39594 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:226
                                1                                                                                                                                                                                                                             
                                |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216      
          THIE_BACSU      - ----MTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR  222
               SCOP domains d1g69a_ A: Thiamin phosphate synthase                                                                                                                                                                                              SCOP domains
               CATH domains 1g69A00 A:10-235 Aldolase class I                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhh.eeeeehhhhh..hhhhhhhhhhhhh..eeee........hhhhhhhhhhhhhhhhhhhh..eeee.hhhhhhhhh..eeee.....hhhhhhhhhh..eeeeee.hhhhhhhhhhhh..eeee.................hhhhhhhhhh.....eeee.......hhhhhhh....eeehhhhhh..hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1g69 A   10 HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR  235
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229      

Chain B from PDB  Type:PROTEIN  Length:228
 aligned with THIE_BACSU | P39594 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:228
                                  1                                                                                                                                                                                                                             
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214        
          THIE_BACSU      - ------MTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR  222
               SCOP domains d1g69b_ B: Thiamin phosphate synthase                                                                                                                                                                                                SCOP domains
               CATH domains 1g69B00 B:1008-1235 Aldolase class I                                                                                                                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhhhhhh.eeeeehhhhh..hhhhhhhhhhhhh..eeee........hhhhhhhhhhhhhhhhhhhh..eeee.hhhhhhhhh..eeee.....hhhhhhhhh...eeeeee.hhhhhhhhhhhh..eeee.................hhhhhhhhhh.....eeee.......hhhhhhh...eeeehhhhhh..hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1g69 B 1008 HHHGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR 1235
                                  1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1G69)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (THIE_BACSU | P39594)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004789    thiamine-phosphate diphosphorylase activity    Catalysis of the reaction: 4-amino-2-methyl-5-diphosphomethylpyrimidine + 4-methyl-5-(2-phosphoethyl)-thiazole + H(+) = diphosphate + thiamine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0009228    thiamine biosynthetic process    The chemical reactions and pathways resulting in the formation of thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
    GO:0009229    thiamine diphosphate biosynthetic process    The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ICP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    POP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TZP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:151 - Pro A:152   [ RasMol ]  
    Gly B:1151 - Pro B:1152   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1g69
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  THIE_BACSU | P39594
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  THIE_BACSU | P39594
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        THIE_BACSU | P395941g4e 1g4p 1g4s 1g4t 1g67 1g6c 2tps 3o15 3o16

(-) Related Entries Specified in the PDB File

1g4e
1g4p
1g4s
1g4t
1g67
1g6c
2tps THIAMIN PHOSPHATE SYNTHASE