|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| NMR Structure (2, 2) |
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (1, 18)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1G1Z) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1G1Z) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:33 aligned with CO6A_CONER | P60513 from UniProtKB/Swiss-Prot Length:32 Alignment length:33 32 10 20 30 | CO6A_CONER 1 DDCIKPYGFCSLPILKNGLCCSGACVGVCADL- - SCOP domains d1g1za_ A: Conotoxin SCOP domains CATH domains --------------------------------- CATH domains Pfam domains --------------------------------- Pfam domains SAPs(SNPs) --------------------------------- SAPs(SNPs) PROSITE --DELTA_CONOTOXIN PDB: A:3-2---- PROSITE Transcript --------------------------------- Transcript 1g1z A 1 DDCIKpYGFCSLPILKNGLCCSGACVGVCADLx 33 | 10 20 30 | 6-HYP 33-NH2
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1G1Z) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1G1Z) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (CO6A_CONER | P60513)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|