|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1FYB) |
Sites (0, 0)| (no "Site" information available for 1FYB) |
SS Bonds (8, 8)
NMR Structure
|
||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1FYB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1FYB) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1FYB) |
Exons (0, 0)| (no "Exon" information available for 1FYB) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:111 aligned with Q40378_NICAL | Q40378 from UniProtKB/TrEMBL Length:397 Alignment length:111 63 73 83 93 103 113 123 133 143 153 163 Q40378_NICAL 54 DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA 164 SCOP domains d1fyba1 A:1-55 Multidomain proteinase inhibitor d1fyba2 A:56-111 Multidomain proteinase inhibitor SCOP domains CATH domains 1fybA01 A:1-51 [code=3.30.60.30, no name defined] 1fybA02 A:52-111 [code=3.30.60.30, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1fyb A 1 DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA 111 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1FYB) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q40378_NICAL | Q40378)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|