|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 3) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1FXR) |
(no "Cis Peptide Bond" information available for 1FXR) |
(no "SAP(SNP)/Variant" information available for 1FXR) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 1FXR) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:64 aligned with FER1_DESAF | P00210 from UniProtKB/Swiss-Prot Length:65 Alignment length:64 11 21 31 41 51 61 FER1_DESAF 2 ARKFYVDQDECIACESCVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQCIHWEDE 65 SCOP domains d1fxra_ A: Ferredoxin I SCOP domains CATH domains 1fxrA00 A:1-64 [code=3.30.70.20, no name defined] CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE -4FE4S_FER_2 PDB: A:2-30 ---------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 1fxr A 1 ARKFYVDQDECIACESCVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQCIHWEDE 64 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:64 aligned with FER1_DESAF | P00210 from UniProtKB/Swiss-Prot Length:65 Alignment length:64 11 21 31 41 51 61 FER1_DESAF 2 ARKFYVDQDECIACESCVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQCIHWEDE 65 SCOP domains d1fxrb_ B: Ferredoxin I SCOP domains CATH domains 1fxrB00 B:1-64 [code=3.30.70.20, no name defined] CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE -4FE4S_FER_2 PDB: B:2-30 ---------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 1fxr B 1 ARKFYVDQDECIACESCVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQCIHWEDE 64 10 20 30 40 50 60
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1FXR) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (FER1_DESAF | P00210)
|
|
|
|
|
|
|