Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL STRUCTURE OF THE MUSCLE FATTY-ACID-BINDING PROTEIN ISOLATED FROM THE DESERT LOCUST, SCHISTOCERCA GREGARIA
 
Authors :  H. M. Holden, N. H. Haunerland
Date :  06 Jul 94  (Deposition) - 20 Dec 94  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Binding Protein(Fatty Acid) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. H. Haunerland, B. L. Jacobson, G. Wesenberg, I. Rayment, H. M. Holden
Three-Dimensional Structure Of The Muscle Fatty-Acid-Binding Protein Isolated From The Desert Locust Schistocerca Gregaria.
Biochemistry V. 33 12378 1994
PubMed-ID: 7918460  |  Reference-DOI: 10.1021/BI00207A004
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MUSCLE FATTY ACID BINDING PROTEIN
    Chains: A, B
    Engineered: YES
    Organism Scientific: SCHISTOCERCA GREGARIA
    Organism Taxid: 7010

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FTP)

(-) Sites  (0, 0)

(no "Site" information available for 1FTP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1FTP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1FTP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1FTP)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FABPPS00214 Cytosolic fatty-acid binding proteins signature.FABPM_SCHGR8-25
 		  2A:7-24
B:7-24

(-) Exons   (0, 0)

(no "Exon" information available for 1FTP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:133
 aligned with FABPM_SCHGR | P41496 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:133
                                    11        21        31        41        51        61        71        81        91       101       111       121       131   
          FABPM_SCHGR     2 VKEFAGIKYKLDSQTNFEEYMKAIGVGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKSTITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYKAQ 134
               SCOP domains d1ftpa_ A: Fatty acid-binding protein                                                                                                 SCOP domains
               CATH domains 1ftpA00 A:1-133  [code=2.40.128.20, no name defined]                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) .......---------hhhhh......hhhhhhh.....eeeeeee....eeeeee....eeeeee.....eeee....eeeeeeeeee....eeeee.....eeeeeee....eeeeee....eeeeeeee. Sec.struct. author (1)
     Sec.struct. author (2) -------eeeeeeeeeeeeee---------------------------------------------------------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------FABP  PDB: A:7-24 ------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ftp A   1 VKEFAGIKYKLDSQTNFEEYMKAIGVGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKSTITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYKAQ 133
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   


Chain B from PDB  Type:PROTEIN  Length:133
 aligned with FABPM_SCHGR | P41496 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:133
                                    11        21        31        41        51        61        71        81        91       101       111       121       131   
          FABPM_SCHGR     2 VKEFAGIKYKLDSQTNFEEYMKAIGVGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKSTITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYKAQ 134
               SCOP domains d1ftpb_ B: Fatty acid-binding protein                                                                                                 SCOP domains
               CATH domains 1ftpB00 B:1-133  [code=2.40.128.20, no name defined]                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) .......---------hhhhh......hhhhhhh.....eeeeeee....eeeeee....eeeeee.....eeee....eeeeeeeeee....eeeee.....eeeeeee....eeeeee....eeeeeeee. Sec.struct. author (1)
     Sec.struct. author (2) -------eeeeeeeeeeeeee---------------------------------------------------------------------------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------FABP  PDB: B:7-24 ------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ftp B   1 VKEFAGIKYKLDSQTNFEEYMKAIGVGAIERKAGLALSPVIELEILDGDKFKLTSKTAIKNTEFTFKLGEEFDEETLDGRKVKSTITQDGPNKLVHEQKGDHPTIIIREFSKEQCVITIKLGDLVATRIYKAQ 133
                                    10        20        30        40        50        60        70        80        90       100       110       120       130
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FTP)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (FABPM_SCHGR | P41496)
molecular function
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ftp)
 
  Sites
(no "Sites" information available for 1ftp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ftp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)
Distance Plot
  representative atom: CA
[ mono GIF format | mono PDF format ]

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ftp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FABPM_SCHGR | P41496
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FABPM_SCHGR | P41496
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1FTP)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FTP)