|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 1FAO) |
(no "SAP(SNP)/Variant" information available for 1FAO) |
Asymmetric/Biological Unit (1, 1)
|
(no "Exon" information available for 1FAO) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:100 aligned with DAPP1_HUMAN | Q9UN19 from UniProtKB/Swiss-Prot Length:280 Alignment length:100 171 181 191 201 211 221 231 241 251 261 DAPP1_HUMAN 162 PSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQI 261 SCOP domains d1faoa_ A: Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH SCOP domains CATH domains 1faoA00 A:162-261 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --PH_DOMAIN PDB: A:164-259 UniProt: 164-259 -- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 1fao A 162 PSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQI 261 171 181 191 201 211 221 231 241 251 261
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1FAO) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A (DAPP1_HUMAN | Q9UN19)
|
|
|
|
|
|
|