|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (1, 1)
NMR Structure
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1F2G) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1F2G) |
PROSITE Motifs (2, 3)
NMR Structure (2, 3)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1F2G) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:58 aligned with FER_DESGI | P00209 from UniProtKB/Swiss-Prot Length:58 Alignment length:58 10 20 30 40 50 FER_DESGI 1 PIEVNDDCMACEACVEICPDVFEMNEEGDKAVVINPDSDLDCVEEAIDSCPAEAIVRS 58 SCOP domains d1f2ga_ A: Ferredoxin I SCOP domains CATH domains 1f2gA00 A:1-58 [code=3.30.70.20, no name defined] CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE (1) 4FE4S_FER_2 PDB: A:1-27 --4FE4S_FER_2 PDB: A:30-58 PROSITE (1) PROSITE (2) -------4FE4S_FER_1 --------------------------------------- PROSITE (2) Transcript ---------------------------------------------------------- Transcript 1f2g A 1 PIEVNDDCMACEACVEICPDVFEMNEEGDKAVVINPDSDLDCVEEAIDSCPAEAIVRS 58 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1F2G) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (FER_DESGI | P00209)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|