![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 2) Biological Unit 1 (1, 4) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1EZJ) |
(no "Cis Peptide Bond" information available for 1EZJ) |
(no "SAP(SNP)/Variant" information available for 1EZJ) |
(no "PROSITE Motif" information available for 1EZJ) |
(no "Exon" information available for 1EZJ) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:114 aligned with PHOSP_SENDH | P04859 from UniProtKB/Swiss-Prot Length:568 Alignment length:114 329 339 349 359 369 379 389 399 409 419 429 PHOSP_SENDH 320 ENTSSMKEMATLLTSLGVIQSAQEFESSRDASYVFARRALKSANYAEMTFNVCGLILSAEKSSARKVDENKQLLKQIQESVESFRDIYKRFSEYQKEQNSLLMSNLSTLHIITD 433 SCOP domains d1ezja_ A: Multimerization domain of the phosphoprotein from sendai virus SCOP domains CATH domains 1ezjA01 A:2-63 [code=1.10.287.320, no name defined] 1ezjA02 A:64-115 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 1ezj A 2 ENTSSMKEMATLLTSLGVIQSAQEFESSRDASYVFARRALKSANYAEMTFNVCGLILSAEKSSARKVDENKQLLKQIQESVESFRDIYKRFSEYQKEQNSLLMSNLSTLHIITD 115 11 21 31 41 51 61 71 81 91 101 111
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1EZJ) |
Asymmetric Unit(hide GO term definitions) Chain A (PHOSP_SENDH | P04859)
|
|
|
|
|
|
|