1EW3 - JenaLib

Title :   CRYSTAL STRUCTURE OF THE MAJOR HORSE ALLERGEN EQU C 1

Authors :   M. B. Lascombe, C. Gregoire, P. Poncet, G. A. Tavares, I. Rosinski- Chupin, J. Rabillon, H. Goubran-Botros, J. C. Mazie, B. David, P. M. Alzari

Date :   21 Apr 00 (Deposition) - 03 May 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Lipocalin, Beta Barrel, Allergen (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. B. Lascombe, C. Gregoire, P. Poncet, G. A. Tavares, I. Rosinski-Chupin, J. Rabillon, H. Goubran-Botros, J. C. Mazie, B. David, P. M. Alzari
Crystal Structure Of The Allergen Equ C 1. A Dimeric Lipocalin With Restricted Ige-Reactive Epitopes.
J. Biol. Chem. V. 275 21572 2000
PubMed-ID: 10787420 | Reference-DOI: 10.1074/JBC.M002854200
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 4)

Asymmetric Unit (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ALL1_HORSE_001 *	V	62	L	ALL1_HORSE	---	---	A	V	62	L
2	UniProt	VAR_ALL1_HORSE_002 *	F	90	A	ALL1_HORSE	---	---	A	F	90	A
3	UniProt	VAR_ALL1_HORSE_003 *	F	136	L	ALL1_HORSE	---	---	A	F	136	L
4	UniProt	VAR_ALL1_HORSE_004 *	S	146	D	ALL1_HORSE	---	---	A	S	146	D
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ALL1_HORSE_001 *	V	62	L	ALL1_HORSE	---	---	A	V	62	L
2	UniProt	VAR_ALL1_HORSE_002 *	F	90	A	ALL1_HORSE	---	---	A	F	90	A
3	UniProt	VAR_ALL1_HORSE_003 *	F	136	L	ALL1_HORSE	---	---	A	F	136	L
4	UniProt	VAR_ALL1_HORSE_004 *	S	146	D	ALL1_HORSE	---	---	A	S	146	D
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:159
 aligned with ALL1_HORSE | Q95182 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:159
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172         
           ALL1_HORSE    23 VAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRG 181
               SCOP domains d1ew3a_ A: Lipocalin allergen                                                                                                                                   SCOP domains
               CATH domains 1ew3A00 A:23-181  [code=2.40.128.20, no name defined]                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee.hhhhh.ee.eeeeeee.hhhhh........eeeeeee.....eeeeeeeee..eeeeeeeeeee.....eeeee...eeeeeeeee....eeeeeeee......eeeeeeee.....hhhhhhhhhhhhhhh..hhh.eee.hhh..hhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------L---------------------------A---------------------------------------------L---------D----------------------------------- SAPs(SNPs)
                    PROSITE ----LIPOCALIN     --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ew3 A  23 VAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRG 181
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Asymmetric Unit(hide GO term definitions)

Chain A (ALL1_HORSE | Q95182)

molecular function
	GO:0005550	pheromone binding	Interacting selectively and non-covalently with a pheromone, a substance, or characteristic mixture of substances, that is secreted and released by an organism and detected by a second organism of the same or a closely related species, in which it causes a specific reaction, such as a definite behavioral reaction or a developmental process.
	GO:0036094	small molecule binding	Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ew3)

	Sites
(no "Sites" information available for 1ew3)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ew3)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ew3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ALL1_HORSE \| Q95182
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ALL1_HORSE \| Q95182
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description