1EJ3 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF AEQUORIN

Authors :   J. F. Head, S. Inouye, K. Teranishi, O. Shimomura

Date :   29 Feb 00 (Deposition) - 31 May 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Four Ef-Hand Calcium-Binding Protein, Protein- Coelenterazine Peroxide Complex, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. F. Head, S. Inouye, K. Teranishi, O. Shimomura
The Crystal Structure Of The Photoprotein Aequorin At 2. 3 A Resolution.
Nature V. 405 372 2000
PubMed-ID: 10830969 | Reference-DOI: 10.1038/35012659
(for further references see the PDB file header)

Molecule 1 - AEQUORIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PIP-HE
	Expression System Taxid	:	562
	Organ	:	LIGHT ORGAN
	Organism Scientific	:	AEQUOREA AEQUOREA
	Organism Taxid	:	168712

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	CZH	2	Ligand/Ion	C2-HYDROPEROXY-COELENTERAZINE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	CZH	1	Ligand/Ion	C2-HYDROPEROXY-COELENTERAZINE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	CZH	1	Ligand/Ion	C2-HYDROPEROXY-COELENTERAZINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:16 , MET A:19 , MET A:36 , ALA A:40 , TYR A:82 , TRP A:86 , TRP A:108 , GLY A:109 , LEU A:112 , PHE A:113 , TRP A:129 , TYR A:132 , MET A:165 , HIS A:169 , TRP A:173 , TYR A:184 , HOH A:405	BINDING SITE FOR RESIDUE CZH A 201
2	AC2	SOFTWARE	HIS B:16 , MET B:19 , MET B:36 , PHE B:66 , TYR B:82 , TRP B:86 , TRP B:108 , GLY B:109 , LEU B:112 , PHE B:113 , TRP B:129 , TYR B:132 , MET B:165 , HIS B:169 , TRP B:173 , TYR B:184 , HOH B:451	BINDING SITE FOR RESIDUE CZH B 301

(no "SS Bond" information available for 1EJ3)

(no "Cis Peptide Bond" information available for 1EJ3)

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_AEQ2_AEQVI_001 *	S	164	N	AEQ2_AEQVI	---	---	A/B	S	157	N
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_AEQ2_AEQVI_001 *	S	164	N	AEQ2_AEQVI	---	---	A	S	157	N
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_AEQ2_AEQVI_001 *	S	164	N	AEQ2_AEQVI	---	---	B	S	157	N
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	AEQ2_AEQVI	18-53 117-146 147-182	6	A:11-46 B:11-46 A:110-139 B:110-139 A:140-175 B:140-175
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	AEQ2_AEQVI	31-43 124-136 160-172	6	A:24-36 B:24-36 A:117-129 B:117-129 A:153-165 B:153-165

Biological Unit 1 (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	AEQ2_AEQVI	18-53 117-146 147-182	3	A:11-46 - A:110-139 - A:140-175 -
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	AEQ2_AEQVI	31-43 124-136 160-172	3	A:24-36 - A:117-129 - A:153-165 -

Biological Unit 2 (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	EF_HAND_2	PS50222	EF-hand calcium-binding domain profile.	AEQ2_AEQVI	18-53 117-146 147-182	3	- B:11-46 - B:110-139 - B:140-175
2	EF_HAND_1	PS00018	EF-hand calcium-binding domain.	AEQ2_AEQVI	31-43 124-136 160-172	3	- B:24-36 - B:117-129 - B:153-165

(no "Exon" information available for 1EJ3)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:187
 aligned with AEQ2_AEQVI | P02592 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:187
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       
           AEQ2_AEQVI    10 LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP 196
               SCOP domains d1ej3a_ A: Calcium-regulated photoprotein                                                                                                                                                   SCOP domains
               CATH domains 1ej3A00 A:3-189 EF-hand                                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhh.....eehhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.......eehhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....eehhhhhhhhhhhhh...hhhhhhhhhhhhh......eehhhhhhhhhhhhh..hhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------N-------------------------------- SAPs(SNPs)
                PROSITE (1) --------EF_HAND_2  PDB: A:11-46             ---------------------------------------------------------------EF_HAND_2  PDB: A:110-139     EF_HAND_2  PDB: A:140-175           -------------- PROSITE (1)
                PROSITE (2) ---------------------EF_HAND_1    --------------------------------------------------------------------------------EF_HAND_1    -----------------------EF_HAND_1    ------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ej3 A   3 LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP 189
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182

Chain B from PDB  Type:PROTEIN  Length:187
 aligned with AEQ2_AEQVI | P02592 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:187
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       
           AEQ2_AEQVI    10 LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP 196
               SCOP domains d1ej3b_ B: Calcium-regulated photoprotein                                                                                                                                                   SCOP domains
               CATH domains 1ej3B00 B:3-189 EF-hand                                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhh.....eeehhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh......eeehhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....eehhhhhhhhhhhhh...hhhhhhhhhhhh.......eehhhhhhhhhhhhh..hhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------N-------------------------------- SAPs(SNPs)
                PROSITE (1) --------EF_HAND_2  PDB: B:11-46             ---------------------------------------------------------------EF_HAND_2  PDB: B:110-139     EF_HAND_2  PDB: B:140-175           -------------- PROSITE (1)
                PROSITE (2) ---------------------EF_HAND_1    --------------------------------------------------------------------------------EF_HAND_1    -----------------------EF_HAND_1    ------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ej3 B   3 LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP 189
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: EF Hand-like (739)

Superfamily: EF-hand (657)

Family: Calmodulin-like (356)

Protein domain: Calcium-regulated photoprotein (11)

Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712] (1)

1a	d1ej3a_	A:
1b	d1ej3b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Recoverin; domain 1 (474)

Homologous Superfamily: EF-hand (412)

Aequorea aequorea. Organism_taxid: 168712. (1)

1a	1ej3A00	A:3-189
1b	1ej3B00	B:3-189

(no "Pfam Domain" information available for 1EJ3)

Asymmetric Unit(hide GO term definitions)

Chain A,B (AEQ2_AEQVI | P02592)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0008218	bioluminescence	The production of light by certain enzyme-catalyzed reactions in cells.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CZH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ej3)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ej3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AEQ2_AEQVI \| P02592
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AEQ2_AEQVI \| P02592
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AEQ2_AEQVI \| P02592	:	1uhh 1uhi 1uhj 1uhk

(no "Related Entries Specified in the PDB File" available for 1EJ3)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (2, 12)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File