Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF RNA POLYMERASE SUBUNIT RPB5 FROM METHANOBACTERIUM THERMOAUTOTROPHICUM
 
Authors :  A. Yee, V. Booth, A. Dharamsi, A. Engel, A. M. Edwards, C. H. Arrowsmith, Northeast Structural Genomics Consortium (Nesg)
Date :  25 Feb 00  (Deposition) - 21 Jun 00  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Rpb5, Rpbh, Rna Polymerase Subunit, Ocsp, Nesg, Protein Structure Initiative, Structural Genomics, Psi, Northeast Structural Genomics Consortium, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Yee, V. Booth, A. Dharamsi, A. Engel, A. M. Edwards, C. H. Arrowsmith
Solution Structure Of The Rna Polymerase Subunit Rpb5 From Methanobacterium Thermoautotrophicum.
Proc. Natl. Acad. Sci. Usa V. 97 6311 2000
PubMed-ID: 10841538  |  Reference-DOI: 10.1073/PNAS.97.12.6311
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RNA POLYMERASE SUBUNIT RPB5
    ChainsA
    EC Number2.7.7.6
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System Taxid562
    Organism ScientificMETHANOTHERMOBACTER THERMAUTOTROPHICUS
    Organism Taxid145262

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1EIK)

(-) Sites  (0, 0)

(no "Site" information available for 1EIK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EIK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1EIK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EIK)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RNA_POL_H_23KDPS01110 RNA polymerases H / 23 Kd subunits signature.RPOH_METTH8-21  1A:8-21

(-) Exons   (0, 0)

(no "Exon" information available for 1EIK)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:77
 aligned with RPOH_METTH | O27122 from UniProtKB/Swiss-Prot  Length:77

    Alignment length:77
                                    10        20        30        40        50        60        70       
            RPOH_METTH    1 MKREILKHQLVPEHVILNESEAKRVLKELDAHPEQLPKIKTTDPVAKAIGAKRGDIVKIIRKSPTAEEFVTYRLVQD 77
               SCOP domains d1eika_ A: RNA polymerase subunit RBP5 (RNA polymerase subunit H)             SCOP domains
               CATH domains 1eikA00 A:1-77  [code=3.90.940.20, no name defined]                           CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeehhhhhhhhhhhh.............hhhhhhhhh....eeeeeeee...eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------RNA_POL_H_23KD-------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                  1eik A  1 MKREILKHQLVPEHVILNESEAKRVLKELDAHPEQLPKIKTTDPVAKAIGAKRGDIVKIIRKSPTAEEFVTYRLVQD 77
                                    10        20        30        40        50        60        70       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EIK)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (RPOH_METTH | O27122)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003899    DNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1). Utilizes a DNA template, i.e. the catalysis of DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. Can initiate a chain 'de novo'.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1eik)
 
  Sites
(no "Sites" information available for 1eik)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1eik)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1eik
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RPOH_METTH | O27122
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.6
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RPOH_METTH | O27122
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1EIK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1EIK)