Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PROTEINASE INHIBITOR EGLIN C WITH HYDROLYSED REACTIVE CENTER
 
Authors :  Z. Dauter, V. Lamzin, C. Betzel, K. S. Wilson
Date :  01 Sep 95  (Deposition) - 07 Dec 95  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Proteinase Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Betzel, Z. Dauter, N. Genov, V. Lamzin, J. Navaza, H. P. Schnebli, M. Visanji, K. S. Wilson
Structure Of The Proteinase Inhibitor Eglin C With Hydrolysed Reactive Centre At 2. 0 A Resolution.
Febs Lett. V. 317 185 1993
PubMed-ID: 8425603  |  Reference-DOI: 10.1016/0014-5793(93)81273-3
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EGLIN-C
    Chains: A
    Organism Common: MEDICINAL LEECH
    Organism Scientific: HIRUDO MEDICINALIS
    Organism Taxid: 6421
    Other Details: CLEAVED BETWEEN RESIDUES 45 AND 46
 
Molecule 2 - EGLIN-C
    Chains: B
    Organism Common: MEDICINAL LEECH
    Organism Scientific: HIRUDO MEDICINALIS
    Organism Taxid: 6421
    Other Details: CLEAVED BETWEEN RESIDUES 45 AND 46

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1EGP)

(-) Sites  (0, 0)

(no "Site" information available for 1EGP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EGP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1EGP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EGP)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1POTATO_INHIBITORPS00285 Potato inhibitor I family signature.ICIC_HIRME10-21  1A:10-21

(-) Exons   (0, 0)

(no "Exon" information available for 1EGP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:39
 aligned with ICIC_HIRME | P01051 from UniProtKB/Swiss-Prot  Length:70

    Alignment length:39
                                    16        26        36         
            ICIC_HIRME    7 LKSFPEVVGKTVDQAREYFTLHYPQYDVYFLPEGSPVTL 45
               SCOP domains d1egp.1 A:,B: Eglin C                   SCOP domains
               CATH domains 1egpA00 A:7-45                          CATH domains
               Pfam domains --------------------------------------- Pfam domains
         Sec.struct. author ....hhh....hhhhhhhhhhh....eeeeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------- SAPs(SNPs)
                    PROSITE ---POTATO_INHIB------------------------ PROSITE
                 Transcript --------------------------------------- Transcript
                  1egp A  7 LKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTL 45
                                    16        26        36         


Chain B from PDB  Type:PROTEIN  Length:22
 aligned with ICIC_HIRME | P01051 from UniProtKB/Swiss-Prot  Length:70

    Alignment length:22
                                    58        68  
            ICIC_HIRME   49 YNRVRVFYNPGTNVVNHVPHVG 70
               SCOP domains d1egp.1 A:,B: Eglin C  SCOP domains
               CATH domains ---------------------- CATH domains
               Pfam domains ---------------------- Pfam domains
         Sec.struct. author ..eeeeee.............. Sec.struct. author
                 SAPs(SNPs) ---------------------- SAPs(SNPs)
                    PROSITE ---------------------- PROSITE
                 Transcript ---------------------- Transcript
                  1egp B 49 YNRVRVFYNPGTNVVNHVPHVG 70
                                    58        68
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EGP)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (ICIC_HIRME | P01051)
molecular function
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1egp)
 
  Sites
(no "Sites" information available for 1egp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1egp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1egp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ICIC_HIRME | P01051
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ICIC_HIRME | P01051
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ICIC_HIRME | P01051: 1acb 1cse 1egl 1mee 1sbn 1sib 1tec 2sec 2tec 3tec 4b1t 4b2a 4b2b 4b2c 4h4f

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1EGP)