|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1DUR) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1DUR) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1DUR) |
PROSITE Motifs (2, 4)
Asymmetric/Biological Unit (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1DUR) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:55 aligned with FER_PEPAS | P00193 from UniProtKB/Swiss-Prot Length:54 Alignment length:55 22 21 | 10 20| | 29 39 49 FER_PEPAS 1 AYVINDSCIACGACKPECPVN-IQQGSIYAIDADSCIDCGSCASVCPVGAPNPED 54 SCOP domains d1dura_ A: Ferredoxin II SCOP domains CATH domains 1durA00 A:1-55 [code=3.30.70.20, no name defined] CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE (1) -------4FE4S_FER_1 ----------------4FE4S_FER_1 -------- PROSITE (1) PROSITE (2) 4FE4S_FER_2 PDB: A:1-2---4FE4S_FER_2 PDB: A:27-55 PROSITE (2) Transcript ------------------------------------------------------- Transcript 1dur A 1 AYVINDSCIACGACKPECPVNCIQEGSIYAIDADSCIDCGSCASVCPVGAPNPED 55 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1DUR) |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (FER_PEPAS | P00193)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|