|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 7)| Asymmetric Unit (2, 7) Biological Unit 1 (1, 6) |
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1DOI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1DOI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1DOI) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1DOI) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:128 aligned with FER1_HALMA | P00217 from UniProtKB/Swiss-Prot Length:129 Alignment length:128 11 21 31 41 51 61 71 81 91 101 111 121 FER1_HALMA 2 PTVEYLNYEVVDDNGWDMYDDDVFGEASDMDLDDEDYGSLEVNEGEYILEAAEAQGYDWPFSCRAGACANCAAIVLEGDIDMDMQQILSDEEVEDKNVRLTCIGSPDADEVKIVYNAKHLDYLQNRVI 129 SCOP domains d1doia_ A: 2Fe-2S ferredoxin SCOP domains CATH domains 1doiA00 A:1-128 [code=3.10.20.30, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---------------------------2FE2S_FER_2 PDB: A:28-119 UniProt: 29-120 --------- PROSITE (1) PROSITE (2) --------------------------------------------------------------2FE2S_FER--------------------------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 1doi A 1 PTVEYLNYEVVDDNGWDMYDDDVFGEASDMDLDDEDYGSLEVNEGEYILEAAEAQGYDWPFSCRAGACANCAAIVLEGDIDMDMQQILSDEEVEDKNVRLTCIGSPDADEVKIVYNAKHLDYLQNRVI 128 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1DOI) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (FER1_HALMA | P00217)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|