|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1DO6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1DO6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1DO6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1DO6) |
Exons (0, 0)| (no "Exon" information available for 1DO6) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:124 aligned with SOR_PYRFU | P82385 from UniProtKB/Swiss-Prot Length:124 Alignment length:124 10 20 30 40 50 60 70 80 90 100 110 120 SOR_PYRFU 1 MISETIRSGDWKGEKHVPVIEYEREGELVKVKVQVGKEIPHPNTTEHHIRYIELYFLPEGENFVYQVGRVEFTAHGESVNGPNTSDVYTEPIAYFVLKTKKKGKLYALSYCNIHGLWENEVTLE 124 SCOP domains d1do6a_ A: Superoxide reductase (SOR) SCOP domains CATH domains 1do6A00 A:1-124 [code=2.60.40.730, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript 1do6 A 1 MISETIRSGDWKGEKHVPVIEYEREGELVKVKVQVGKEIPHPNTTEHHIRYIELYFLPEGENFVYQVGRVEFTAHGESVNGPNTSDVYTEPIAYFVLKTKKKGKLYALSYCNIHGLWENEVTLE 124 10 20 30 40 50 60 70 80 90 100 110 120 Chain B from PDB Type:PROTEIN Length:124 aligned with SOR_PYRFU | P82385 from UniProtKB/Swiss-Prot Length:124 Alignment length:124 10 20 30 40 50 60 70 80 90 100 110 120 SOR_PYRFU 1 MISETIRSGDWKGEKHVPVIEYEREGELVKVKVQVGKEIPHPNTTEHHIRYIELYFLPEGENFVYQVGRVEFTAHGESVNGPNTSDVYTEPIAYFVLKTKKKGKLYALSYCNIHGLWENEVTLE 124 SCOP domains d1do6b_ B: Superoxide reductase (SOR) SCOP domains CATH domains 1do6B00 B:1-124 [code=2.60.40.730, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript 1do6 B 1 MISETIRSGDWKGEKHVPVIEYEREGELVKVKVQVGKEIPHPNTTEHHIRYIELYFLPEGENFVYQVGRVEFTAHGESVNGPNTSDVYTEPIAYFVLKTKKKGKLYALSYCNIHGLWENEVTLE 124 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1DO6) |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A,B (SOR_PYRFU | P82385)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|